Recombinant Vibrio cholerae serotype O1 CAI-1 autoinducer sensor kinase/phosphatase CqsS (cqsS)

Shipped with Ice Packs
In Stock

Description

Introduction to CqsS and Quorum Sensing

The CqsS protein functions as a receptor in one of the two primary quorum-sensing systems in Vibrio cholerae, the causative agent of cholera disease. V. cholerae uses two parallel autoinducer-receptor quorum-sensing systems: AI-2/LuxPQ and CAI-1/CqsS, which together regulate biofilm formation and virulence factor production . The CAI-1/CqsS system is particularly significant as it enables V. cholerae to detect the presence of its own kind before committing to high-cell-density behaviors .

CqsS specifically detects CAI-1, chemically identified as (S)-3-hydroxytridecan-4-one, which is produced by the CqsA synthase . This detection initiates a signaling cascade that influences gene expression patterns related to virulence and biofilm formation. As a two-component sensor histidine kinase, CqsS possesses dual functionality with both kinase and phosphatase activities .

Functional Mechanism of CqsS in Quorum Sensing

CqsS functions through a phosphorelay signaling cascade that translates extracellular quorum sensing signals into intracellular responses. The signaling pathway involves a three-protein cascade: CqsS → LuxU → LuxO . This relatively simple circuit makes it an ideal model system for studying ligand regulation of histidine kinases .

The functional mechanism of CqsS can be described in two primary states:

  1. Low Cell Density State: In the absence of sufficient CAI-1, CqsS acts as a kinase, initiating phosphorylation of the cascade.

  2. High Cell Density State: When CAI-1 accumulates to threshold levels, it binds to CqsS, inhibiting its kinase activity and promoting its phosphatase activity.

Research has shown that CAI-1 specifically inhibits the initial auto-phosphorylation of CqsS, while subsequent phosphotransfer steps and CqsS phosphatase activity remain unaffected by CAI-1 . The binding of CAI-1 to CqsS causes a conformational change that renders His194 inaccessible to the CqsS catalytic domain .

Species-Specific Ligand Recognition

The CqsS receptors from different Vibrio species exhibit remarkable specificity for different CAI-1 variants, demonstrating evolutionary adaptation to species-specific signaling:

Vibrio SpeciesPreferred LigandKey Position 170 ResidueTail Length Preference
V. cholerae(S)-3-hydroxytridecan-4-oneCysteine (C170)10-carbon
V. harveyi(Z)-3-aminoundec-2-en-4-one (Ea-C8-CAI-1)Phenylalanine8-carbon

This species specificity has important implications for understanding how bacteria distinguish between their own kind and other species in mixed microbial communities. Interestingly, while V. harveyi shows exquisite selectivity for production and detection of its own ligand, V. cholerae CqsA/CqsS counterparts demonstrate relaxed specificity in both production and detection .

Role in V. cholerae Pathogenesis and Biofilm Regulation

The CAI-1/CqsS system plays a critical role in regulating V. cholerae's pathogenicity and biofilm lifecycle. Research has revealed that the CqsS pathway is activated when only a few V. cholerae cells are present, whereas the parallel AI-2 pathway requires much higher cell density for activation .

AutoinducerProduced ByDetected ByActivation ThresholdPrimary Function
CAI-1CqsA synthaseCqsS receptorFew thousand cells/mLKin verification
AI-2LuxS synthaseLuxPQ receptorMuch higher cell densityBacterial population density gauge

This asymmetry means that exogenous sources of AI-2, but not CAI-1, can contribute to satisfying the coincidence detector to repress biofilm formation and promote dispersal . This represents the first report of unique roles for different V. cholerae autoinducers and suggests that detection of kin fosters distinct outcomes from detection of non-kin .

In Vitro Studies and Biochemical Properties

Researchers have successfully reconstituted the CqsS → LuxU → LuxO phosphorylation cascade in vitro, providing valuable insights into the biochemical properties of CqsS . These studies have confirmed that CAI-1 inhibits the auto-phosphorylation of CqsS but does not affect subsequent phosphotransfer steps or phosphatase activity .

The cloning and overexpression of the CqsS receptor in recombinant Escherichia coli has enabled examination of in vitro auto-phosphorylation of CqsS (H1) . These investigations have revealed that CAI-1 binding to CqsS causes a conformational change that renders the His194 residue inaccessible to phosphorylation by the catalytic domain .

Mutational studies have yielded CqsS variants with altered ligand detection specificities that remain faithfully controlled by their corresponding modified ligands in vitro . This has allowed the assessment of both agonists and antagonists and their opposing activities in controlled laboratory settings .

Implications for Environmental Detection of V. cholerae

Research has demonstrated that certain naturally occurring variant strains of V. cholerae non-O1 non-O139 overproduce AI-2, which can enhance the resuscitation of dormant V. cholerae cells in environmental water samples . Laboratory studies with mutant strains having inactivated cqsS genes have shown similar overproduction of AI-2 .

The nucleotide sequence and predicted protein products of the cqsS gene carried by AI-2 overproducing variant strains show divergence from that of typical V. cholerae O1 or non-O1 strains . This genetic variation has implications for how different strains might interact in environmental settings and potentially contribute to cholera epidemics through enhanced resuscitation of dormant pathogenic strains.

Future Research Directions and Therapeutic Potential

The detailed understanding of the structure-function relationship of CqsS offers promising avenues for therapeutic interventions. By exploiting the chemical-genetics approach, researchers have identified specific amino acids in the CqsS sensor that play particular roles in ligand recognition . This knowledge enables the rational design of synthetic ligands that could potentially be used to control histidine kinase activity .

Future research will likely focus on developing synthetic analogs of CAI-1 that could serve as antagonists to disrupt quorum sensing in V. cholerae, potentially reducing virulence without applying selective pressure associated with traditional antibiotics. The ability to combine mutations to build CqsS receptors responsive to ligand analogues altered at both the head and tail provides a powerful tool for such drug development efforts .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
cqsS; VC_A0522; CAI-1 autoinducer sensor kinase/phosphatase CqsS; Cholerae quorum-sensing sensor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-686
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Target Names
cqsS
Target Protein Sequence
MIVSMDVIKRVYQYAEPNLSLVGWMGMLGFPAYYFIWEYWFPQSYENLGLRCAAAVLFGG LVFRDSMPKKWQRYMPGYFLFTIGFCLPFFFAFMMLMNDWSTIWAMSFMASIFLHILLVH DTRVMALQALFSVLVAYLAVYGLTDFHPTTLIEWQYIPIFLFTYVFGNLCFFRNQISHET KVSIAKTFGAGIAHEMRNPLSALKTSIDVVRTMIPKPQTAAHTDYSLDAQELDLLHQILN EADDVIYSGNNAIDLLLTSIDENRVSPASFKKHSVVDVIEKAVKTFPYKNAADQHSVELE VHQPFDFFGSDTLLTYALFNLLKNAFYYQKEHFSVCISIEQTSEHNLIRVRDNGVGIAPE MLEDIFRDFYTFGKNGSYGLGLPFCRKVMSAFGGTIRCASQQGQWTEFVLSFPRYDSDTV NEIKTELLKTKSLIYIGSNQAIVRELNQLAVEDEFGFTAISAQQAVRRQDYEFEFDLILL DLDDATAQGELLPKLEGTLSFAEGCIGYVYDPGKTYAVNINRYLRIQPISIHSILRKPRK IIERLLFEQESLSMNRNVIPLQKSRHERRILVVDDNQSIRTFTAILLEQQGYEVVQANDG SEVLKHMESQNIDLVLMDIEMPNVGGLEATRLIRNSEHEYKNIPIIGYTGDNSPKTLALV QTSGMNDFIVKPADRDVLLNKVAAWV
Uniprot No.

Target Background

Function
CqsS senses the quorum-sensing autoinducer CAI-1 ((S)-3-hydroxytridecan-4-one), likely functioning as an intragenus signaling molecule. This sensory input is then transmitted to LuxU and LuxO.
Database Links

KEGG: vch:VCA0522

STRING: 243277.VCA0522

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of the CqsS sensor kinase in Vibrio cholerae?

CqsS is a membrane-bound two-component sensor histidine kinase that functions as part of V. cholerae's quorum sensing system. The protein contains N-terminal transmembrane sensing domains that detect the autoinducer CAI-1, a dimerization histidine phosphotransfer (DHp) domain, and a C-terminal catalytic ATP-binding (CA) domain. The sensing domain specifically binds to (S)-3-hydroxytridecan-4-one (CAI-1), while the histidine residue (His194) in the DHp domain serves as the site of autophosphorylation in response to environmental signals .

How does the CqsS phosphorelay cascade function in signal transduction?

The CqsS phosphorelay cascade operates through a three-protein signal transduction pathway (CqsS → LuxU → LuxO) that converts extracellular autoinducer concentration into intracellular transcriptional responses. When CAI-1 levels are low (low cell density), CqsS functions as a kinase, autophosphorylating at His194 and transferring the phosphate group to LuxU, which subsequently phosphorylates LuxO. At high cell density, when CAI-1 accumulates, CAI-1 binding to CqsS causes a conformational change that inhibits the initial autophosphorylation of CqsS, rendering His194 inaccessible to the catalytic domain. This inhibition shifts CqsS to function primarily as a phosphatase, ultimately leading to the dephosphorylation of LuxO and altered gene expression patterns .

What is known about the biosynthetic pathway of CAI-1 in V. cholerae?

The biosynthesis of CAI-1 involves the CqsA enzyme, which catalyzes a unique reaction combining (S)-adenosylmethionine (SAM) and decanoyl-coenzyme A to produce 3-aminotridec-2-en-4-one (Ea-CAI-1). This reaction represents a novel enzymatic mechanism that combines two transformations—a β,γ-elimination of SAM and an acyltransferase reaction—into a single PLP-dependent catalytic process. Ea-CAI-1 is subsequently converted to CAI-1, likely through the intermediate tridecane-3,4-dione (DK-CAI-1). The conversion of Ea-CAI-1 to DK-CAI-1 appears to occur spontaneously, while the conversion of DK-CAI-1 to CAI-1 is enzyme-catalyzed by VC1059 (a reductase) .

What are the established methods for reconstituting the CqsS phosphorylation cascade in vitro?

Researchers can reconstitute the CqsS → LuxU → LuxO phosphorylation cascade in vitro by purifying the component proteins and testing their activities under controlled conditions. The standard methodology involves expressing recombinant CqsS (typically the cytoplasmic portion containing the DHp and CA domains), LuxU, and LuxO proteins with appropriate tags for purification. Phosphorylation assays typically utilize [γ-32P]ATP to monitor the initial autophosphorylation of CqsS, subsequent phosphotransfer to LuxU, and final phosphorylation of LuxO. CAI-1 or its analogs can be added to the reaction mixture to study ligand-dependent inhibition of CqsS kinase activity. This in vitro system provides a powerful approach for analyzing the mechanistic details of each step in the phosphorelay cascade and how they are affected by various ligands .

How can mutations be introduced to study altered ligand specificity of CqsS?

To study altered ligand specificity of CqsS, researchers employ site-directed mutagenesis of the cqsS gene, focusing on residues within the transmembrane sensing domains that are predicted to interact with CAI-1. The standard approach involves:

  • Identifying candidate residues through sequence alignment, structural modeling, or previous experimental data

  • Generating point mutations using PCR-based site-directed mutagenesis

  • Constructing expression vectors containing the mutated cqsS sequences

  • Transforming these constructs into V. cholerae strains with deleted native cqsS

  • Assessing ligand binding and response using reporter systems (often bioluminescence-based)

  • Testing both natural CAI-1 and synthetic analogs to determine changes in specificity

This approach has successfully generated CqsS mutants with altered ligand detection specificities that respond to modified ligands both in vivo and in vitro, allowing researchers to study the structural basis of ligand recognition and receptor activation .

What bioluminescent reporter systems can be used to measure autoinducer activity in V. cholerae?

Bioluminescent reporter systems provide sensitive tools for measuring autoinducer activity in V. cholerae. These systems typically employ a set of engineered V. cholerae strains, each designed to respond exclusively to one quorum-sensing autoinducer (AI-2, CAI-1, or DPO) when supplied exogenously. The reporter strains contain a luciferase operon fused to promoters that are regulated by the corresponding quorum-sensing system. When the specific autoinducer is present, it activates or represses the promoter, leading to changes in light production that can be quantified using a luminometer.

The dynamic ranges for these assays vary considerably: the CAI-1 assay has a dynamic range of approximately 1,000-fold, the DPO assay about 4-fold, and the AI-2 assay approximately 100,000-fold. To measure autoinducer production under different conditions, cell-free culture fluids are collected and added to the appropriate reporter strain, and the resulting bioluminescence is measured. This methodology enables researchers to quantitatively assess how environmental factors, genetic modifications, or chemical treatments affect autoinducer production and quorum sensing .

How do oxygen levels affect CAI-1 production and quorum sensing in V. cholerae?

Oxygen availability significantly impacts CAI-1 production in V. cholerae. Under anaerobic conditions, which mimic the oxygen-limited environment of the human intestine, V. cholerae produces no detectable CAI-1, whereas aerobically grown cells produce substantial amounts. This oxygen-dependent regulation appears to be specific to the CAI-1/CqsS pathway, as other autoinducers (AI-2 and DPO) show increased production under anaerobic conditions—approximately twice as much compared to aerobic growth.

The absence of CAI-1 under anaerobic conditions effectively disables one arm of the V. cholerae quorum sensing system, potentially altering the bacterium's ability to coordinate group behaviors. This finding has important implications for understanding V. cholerae pathogenesis, as the human small intestine (the site of cholera infection) is relatively anaerobic. The oxygen-dependent regulation of CAI-1 production may represent an adaptation that allows V. cholerae to fine-tune its virulence expression according to its location within the host .

What is the relationship between host bile salts and V. cholerae quorum sensing?

Host-produced bile salts interact with V. cholerae quorum sensing systems, particularly affecting the VqmA-dependent pathway. The presence of bile salts in combination with anaerobic conditions (as found in the small intestine) influences QS function and, consequently, pathogenicity. The VqmA protein can function both in its apo form and when bound to the autoinducer DPO (3,5-dimethylpyrazin-2-ol), with DPO-bound VqmA (Holo-VqmA) being more potent at activating expression of the VqmR regulatory small RNA.

This integration of host environmental cues (bile salts) with bacterial cell density signals enables V. cholerae to optimize its virulence capacity in the specific niche of the human intestine. At high cell density, all three QS systems (including the CAI-1/CqsS system) repress genes required for virulence and biofilm formation, suggesting a sophisticated regulatory network that responds to multiple environmental inputs .

What conformational changes occur in CqsS upon ligand binding?

Ligand binding to CqsS induces significant conformational changes that alter its enzymatic activity. When CAI-1 binds to the N-terminal transmembrane sensing domain of CqsS, it triggers a structural rearrangement that propagates to the cytoplasmic catalytic domains. This conformational change specifically renders His194 in the DHp domain inaccessible to the catalytic domain, thereby inhibiting the initial autophosphorylation step.

Importantly, this conformational regulation appears to be specific to the autophosphorylation reaction, as subsequent phosphotransfer steps and CqsS phosphatase activity are not directly controlled by CAI-1 binding. This mechanism allows for precise control of the phosphorelay cascade based on autoinducer concentration, enabling a binary switch between kinase-dominant and phosphatase-dominant states of CqsS. This finding supports a two-state model for ligand control of histidine kinases, where binding of the autoinducer shifts the equilibrium between active and inactive conformations .

How do agonists and antagonists differentially regulate CqsS activity?

Agonists and antagonists of CqsS exert opposing effects on its kinase activity through distinct mechanisms of receptor engagement. Agonists, such as CAI-1 and its derivatives, bind to the CqsS transmembrane sensing domain and stabilize the conformation that inhibits autophosphorylation, effectively shifting CqsS toward its phosphatase-dominant state. This leads to dephosphorylation of the phosphorelay components and altered gene expression.

Antagonists, on the other hand, bind to CqsS but fail to induce the conformational change needed to inhibit autophosphorylation. Some antagonists may competitively block agonist binding without affecting CqsS activity, while others might induce alternative conformational changes that enhance kinase activity. The relative potency of agonists versus antagonists can be assessed in vitro by reconstituting the phosphorylation cascade and measuring CqsS autophosphorylation or phosphotransfer to LuxU in the presence of these competing molecules. This pairing of agonists and antagonists provides valuable tools for dissecting the molecular mechanisms of CqsS regulation and for potentially developing compounds that can modulate quorum sensing in vivo .

How can synthetic biology approaches be used to engineer the CqsS signaling pathway?

Synthetic biology offers powerful approaches for engineering the CqsS signaling pathway for research and potential therapeutic applications. Advanced strategies include:

  • Receptor engineering: Through site-directed mutagenesis and directed evolution, researchers can create CqsS variants with altered ligand specificities, enabling response to non-native signaling molecules or tuning sensitivity to natural ligands.

  • Synthetic circuit design: The CqsS → LuxU → LuxO phosphorelay can be integrated into synthetic gene circuits by connecting LuxO-regulated promoters to heterologous output genes, creating programmable cellular behaviors triggered by specific autoinducer concentrations.

  • Chimeric receptors: Fusion of the CqsS sensing domain with alternative output domains can create hybrid receptors that convert autoinducer detection into novel cellular responses beyond the native phosphorelay.

  • Orthogonal communication systems: Engineering bacteria to produce and detect non-native autoinducers through modified CqsA/CqsS pairs enables the creation of specific cell-to-cell communication channels that do not interfere with natural quorum sensing networks.

These approaches build upon foundational work demonstrating that CqsS mutants with altered ligand detection specificities can be faithfully controlled by their corresponding modified ligands, providing modular components for synthetic biology applications .

What therapeutic strategies target the CqsS signaling pathway to control V. cholerae virulence?

The CAI-1/CqsS signaling pathway offers promising targets for therapeutic intervention against V. cholerae infections. Several strategies under investigation include:

  • Autoinducer mimics: Synthetic CAI-1 analogs that activate CqsS can repress virulence genes in vitro, potentially reducing V. cholerae pathogenicity without generating selective pressure associated with traditional antibiotics.

  • Engineered probiotic approach: Commensal bacteria engineered to express the cqsA gene produce CAI-1 and have been shown to inhibit V. cholerae pathogenesis in an infant mouse model. Pretreatment with E. coli Nissle strain expressing cqsA increased survival rates by up to 92% following V. cholerae challenge, with immunostaining revealing an 80% reduction in cholera toxin binding to mouse intestines after 8 hours of pretreatment .

  • CqsS antagonists: Molecules that bind CqsS but prevent its transition to phosphatase-dominant state could potentially lock V. cholerae in a low cell density transcriptional program, preventing the expression of genes required for colonization and persistence.

  • Targeting the biosynthetic pathway: Inhibitors of CqsA could block CAI-1 production, disrupting quorum sensing regulation of virulence factor expression.

These approaches represent non-traditional anti-infective strategies that could potentially reduce cholera disease severity without conventional antibacterial activity, potentially reducing the development of resistance .

How does the CqsS system compare to other two-component quorum sensing systems in bacteria?

The CqsS system in V. cholerae represents a specialized variant of bacterial two-component signaling systems, with several distinctive features when compared to other quorum sensing systems:

  • Signal integration complexity: V. cholerae employs multiple parallel quorum sensing systems (CAI-1/CqsS, AI-2/LuxPQ, and DPO/VqmA) that converge on a shared regulatory network, allowing integration of diverse chemical signals. This contrasts with simpler systems that rely on a single autoinducer/receptor pair.

  • Receptor architecture: While CqsS follows the canonical domain organization of sensor histidine kinases (sensing, DHp, and CA domains), its transmembrane sensing domain has evolved specialized binding pockets for CAI-1 detection, distinguishing it from other autoinducer receptors.

  • Regulatory mechanism: The CqsS phosphorelay cascade involves three proteins (CqsS → LuxU → LuxO), fewer than some complex systems but more than the simplest two-component systems that directly couple a sensor kinase to a response regulator.

  • Signal chemistry: The use of (S)-3-hydroxytridecan-4-one (CAI-1) as a signaling molecule represents a distinct chemical class compared to the acyl-homoserine lactones used by many Gram-negative bacteria or the oligopeptides employed by Gram-positive species for quorum sensing .

What evolutionary adaptations of the CqsS system enable V. cholerae to thrive in diverse environments?

The CqsS quorum sensing system exhibits several evolutionary adaptations that enhance V. cholerae's ability to navigate between environmental reservoirs and human hosts:

  • Environmental responsiveness: The oxygen-dependent regulation of CAI-1 production represents an adaptation that allows V. cholerae to detect its transition from aquatic environments (aerobic) to the human intestine (relatively anaerobic). The absence of CAI-1 under anaerobic conditions effectively disables one arm of the quorum sensing network, potentially altering virulence expression patterns specifically within the host .

  • Integration with host signals: The V. cholerae QS system has evolved to respond not only to bacterial cell density but also to host-specific cues like bile salts, enabling precise control of virulence expression within the human intestine .

  • Signaling molecule stability: The CAI-1 molecule represents a chemically stable signaling compound that can function in both aquatic environments and the host intestine, unlike some other bacterial communication molecules that might be degraded under certain conditions.

  • Metabolic efficiency: The biosynthetic pathway for CAI-1 leverages common metabolic substrates like SAM, which is already abundant in bacterial cells for other essential functions, representing an efficient repurposing of existing metabolic infrastructure for signaling purposes .

These adaptations collectively enable V. cholerae to sense its environment, coordinate group behaviors, and optimize virulence factor expression according to its current niche, contributing to its success as both an environmental organism and a human pathogen .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.