Recombinant Vibrio cholerae serotype O1 Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is produced via E. coli expression systems and purified to >90% homogeneity using affinity chromatography .

Functional Insights

The Rnf complex in V. cholerae is implicated in:

  • Energy Metabolism: Coupling electron transfer to sodium ion translocation, generating ATP or ion gradients .

  • Virulence: Indirectly supporting pathogen survival under host intestinal conditions (e.g., anaerobic respiration) .

Comparative Roles of Rnf Complex Subunits:

SubunitFunctionRelevance to Pathogenicity
RnfAStabilizes complex structureRequired for biofilm formation
RnfEIon channel regulationLinked to oxidative stress response

Research Applications

  • Antibody Development: Used as an antigen for generating anti-RnfE antibodies .

  • Enzyme Activity Assays: Studying electron transport kinetics and ion flux mechanisms.

  • Structural Studies: Cryo-EM or X-ray crystallography to map interaction sites .

Limitations and Future Directions

While recombinant RnfE enables in vitro studies, its in vivo role in V. cholerae pathogenicity remains understudied. Current genomic analyses suggest Rnf complexes may enhance survival in nutrient-limited environments, but direct evidence is lacking .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preference for a specific tag type, please inform us, and we will prioritize its development.
Synonyms
rnfE; VC0395_A0533; VC395_1027; Ion-translocating oxidoreductase complex subunit E; Rnf electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Target Names
VC0395_A0533
Target Protein Sequence
MSENRTLMLNGMWNNNPALVQLLGLCPLLAVSSTVTNALGLGIATLLVLVGSNVTVSLVR DYVPKEVRIPVFVMIIASLVTCVQLLMNAYAYGLYLSLGIFIPLIVTNCIIIGRAEAFAS KNDVLPAALDGFWMGLGMTSVLVVLGSLREIIGNGTLFDGADLLLGEWAKVLRIEVFHFD SAFLLALLPPGAFIGVGFLIAAKSVIDKQIAARQPKQQKQAIERARVTNV
Uniprot No.

Target Background

Function
This protein is part of a membrane-bound complex responsible for coupling electron transfer with ion translocation across the membrane.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of RnfE in Vibrio cholerae electron transport?

RnfE functions as a component of the Rnf complex in V. cholerae, participating in electron transport and energy conservation through the generation of electrochemical gradients across the cell membrane. While V. cholerae's Na+-NQR system has been well-characterized as generating sodium gradients by coupling NADH oxidation to ion translocation , the Rnf complex likely provides a complementary electron transport pathway active under specific environmental conditions. The Rnf complex typically functions as a ferredoxin:NAD+ oxidoreductase, transferring electrons while pumping ions across the membrane, which contributes to V. cholerae's metabolic versatility in diverse environments.

How does RnfE relate to other electron transport systems like Na+-NQR in V. cholerae?

V. cholerae possesses multiple electron transport systems, with Na+-NQR being the most thoroughly characterized. The Na+-NQR contains six subunits (NqrA, B, C, D, E, and F) and unique cofactors that shuttle electrons from NADH across the membrane to quinone, coupled to the translocation of two Na+ ions . The Rnf complex, including RnfE, represents a distinct electron transport system that likely functions under different metabolic conditions. While Na+-NQR primarily uses NADH as an electron donor, the Rnf complex typically uses reduced ferredoxin. These complementary systems likely enable V. cholerae to maintain energy production across the diverse environments it encounters, from aquatic habitats to the human intestine.

What is the genomic context of the rnfE gene in V. cholerae O1 serotype?

V. cholerae possesses a complex genomic organization with two circular chromosomes: Chr1 (2.96 Mb, 47.7% G+C) and Chr2 (1.07 Mb, 46.9% G+C). Chr1 contains most genes for essential cellular functions and virulence factors, while Chr2 has fewer such genes and contains a large integron with functionally diverse genes .

The rnfE gene is typically located within a conserved gene cluster containing other components of the Rnf complex. The genomic context is particularly significant given V. cholerae's remarkable ability to adapt through mobile genetic elements (MGEs), including genomic islands and integrative conjugative elements . Researchers analyzing the genomic context of rnfE should consider its chromosomal location and potential association with MGEs, as this may impact its distribution and evolution across V. cholerae strains.

What expression systems are optimal for producing functional recombinant V. cholerae RnfE protein?

For membrane-associated electron transport proteins like RnfE, multiple expression systems should be evaluated with the following considerations:

  • E. coli-based systems: Most commonly employed for bacterial protein expression, specialized strains such as C41(DE3) or C43(DE3) that are adapted for membrane protein expression are recommended for RnfE.

  • Cell-free expression systems: Advantageous for potentially toxic membrane proteins, allowing direct incorporation into liposomes or nanodiscs.

  • Homologous expression in V. cholerae: May preserve native conformation and post-translational modifications, though typically yields lower protein amounts.

A systematic optimization approach should include:

  • Testing moderate-strength inducible promoters to prevent toxic accumulation

  • Varying induction conditions (temperature, inducer concentration, duration)

  • Incorporating appropriate fusion tags (His6, Strep-II, FLAG) for detection and purification

  • Co-expressing molecular chaperones to improve folding efficiency

Expression validation requires multiple techniques including Western blotting, activity assays, and microscopic localization to confirm proper folding and membrane integration.

What purification challenges are specific to membrane-associated electron transport proteins like RnfE?

Purifying membrane proteins like RnfE presents several unique challenges that require specialized approaches:

  • Membrane extraction: Requires careful detergent selection to maintain structural and functional integrity. For electron transport proteins with multiple cofactors similar to those in Na+-NQR , mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) are preferred.

  • Cofactor retention: RnfE likely contains iron-sulfur clusters similar to those in electron transport proteins. These cofactors can be lost during purification, necessitating buffers with reducing agents like DTT or β-mercaptoethanol.

  • Complex integrity: If studying the entire Rnf complex, conditions must be optimized to maintain interactions between all subunits.

  • Functional assessment: Unlike soluble proteins, membrane proteins require reconstitution into a lipid environment (proteoliposomes or nanodiscs) for accurate functional evaluation.

A typical purification workflow would include:

  • Membrane fraction isolation via ultracentrifugation

  • Selective solubilization with optimized detergent conditions

  • Affinity chromatography utilizing fusion tags

  • Size exclusion chromatography to remove aggregates

  • Functional reconstitution into liposomes or nanodiscs

What analytical methods best confirm the structural integrity of purified RnfE protein?

Confirming structural integrity of purified RnfE requires multiple complementary approaches:

  • Spectroscopic methods:

    • Circular dichroism (CD) spectroscopy to assess secondary structure composition

    • Fluorescence spectroscopy to evaluate tertiary structure if intrinsic fluorophores are present

    • Electron paramagnetic resonance (EPR) to characterize iron-sulfur clusters

  • Biophysical techniques:

    • Thermal shift assays to determine protein stability

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to confirm monodispersity

    • Limited proteolysis to identify stable domains

  • Functional assays:

    • Electron transfer activity measurements using artificial electron donors/acceptors

    • Ion translocation assays in reconstituted liposomes

    • Binding assays for interaction partners

Similar to approaches used for Na+-NQR in V. cholerae , structural confirmation might ultimately require high-resolution techniques like cryo-EM or X-ray crystallography, which demand exceptional sample quality and homogeneity.

What experimental strategies best determine the electron transport function of RnfE?

Characterizing the electron transport function of RnfE requires multiple complementary approaches:

  • Spectroscopic methods:

    • UV-visible spectroscopy to monitor redox-dependent spectral changes

    • Electron paramagnetic resonance (EPR) to characterize iron-sulfur clusters

    • Fluorescence spectroscopy if flavin cofactors are present (as observed in Na+-NQR )

  • Electrochemical techniques:

    • Protein film voltammetry to determine redox potentials

    • Chronoamperometry to measure electron transfer rates

    • Cyclic voltammetry to identify redox-active centers

  • Reconstitution systems:

    • Proteoliposome-based assays to measure ion translocation coupled to electron transport

    • Patch-clamp techniques for direct measurement of ion currents

  • Genetic approaches:

    • Creation of rnfE deletion mutants in V. cholerae

    • Complementation with wild-type or site-directed mutants

    • Suppressor mutation analysis to identify functional interactions

Experimental ApproachInformation ObtainedTechnical Requirements
EPR SpectroscopyIdentity and redox state of Fe-S clustersLow-temperature equipment, purified protein
Proteoliposome AssaysIon translocation activityLipid reconstitution, ion-sensitive probes
Deletion MutantsPhysiological role of RnfEGenetic tools for V. cholerae, phenotypic assays
Protein Film VoltammetryRedox potentials, electron transfer ratesElectrode modification, anaerobic chamber

How can researchers distinguish between the functions of RnfE and Na+-NQR in V. cholerae?

Differentiating the functions of RnfE and Na+-NQR requires targeted experimental strategies:

  • Genetic discrimination:

    • Generate single and double knockout mutants (ΔrnfE, ΔnqrF, and ΔrnfE/ΔnqrF)

    • Conduct growth studies under varying conditions (aerobic/anaerobic, different carbon sources)

    • Perform complementation studies to confirm phenotype specificity

  • Biochemical discrimination:

    • Utilize specific inhibitors of Na+-NQR (such as HQNO or korormicin)

    • Analyze substrate specificity differences (Na+-NQR uses NADH and ubiquinone , while Rnf likely uses ferredoxin and NAD+)

    • Measure ion specificity (Na+ vs. H+) using ion-selective electrodes or fluorescent indicators

  • Expression analysis:

    • Monitor differential expression under varying growth conditions

    • Examine protein levels during host infection or environmental transitions

    • Use quantitative proteomics to measure stoichiometric relationships

Based on known characteristics of Na+-NQR in V. cholerae , key differences likely include electron donor/acceptor preferences, ion specificity, inhibitor sensitivity, and expression patterns under different environmental conditions.

What is the relationship between RnfE activity and V. cholerae pathogenesis?

The relationship between electron transport systems and V. cholerae pathogenesis involves several interconnected mechanisms:

  • Metabolic adaptation during infection:

    • The intestinal environment presents unique redox conditions and nutrient availability

    • Electron transport systems like RnfE may enable metabolic flexibility crucial for colonization

    • Energy generation through ion gradients supports growth and virulence factor production

  • Ion homeostasis:

    • Na+ gradients generated by electron transport complexes like Na+-NQR are essential for V. cholerae physiology

    • Ion homeostasis affects expression of virulence factors, which are often environmentally regulated

  • Stress response:

    • Electron transport systems help bacteria respond to oxidative stress during host immune responses

    • Maintenance of redox balance impacts survival in host environments

  • Virulence regulation:

    • V. cholerae expresses numerous virulence factors including toxins, adhesins, and surface antigens

    • Metabolic state influences regulatory networks controlling virulence gene expression

To investigate this relationship, researchers should:

  • Analyze virulence factor expression in rnfE mutants

  • Assess colonization efficiency in animal models

  • Examine rnfE expression during different infection stages

  • Investigate correlations between electron transport activity and toxin production

How does horizontal gene transfer affect rnfE distribution among V. cholerae strains?

Horizontal gene transfer (HGT) significantly influences V. cholerae evolution and genetic diversity. The distribution of rnfE among strains may be affected through several mechanisms:

  • Mobile genetic elements:

    • V. cholerae genomes contain numerous mobile genetic elements including genomic islands, integrative conjugative elements, and prophages

    • If rnfE is located on or near these elements, its transfer between strains would be facilitated

  • Natural competence:

    • V. cholerae can acquire DNA fragments exceeding 150 kbp through natural competence

    • This mechanism could facilitate transfer of entire gene clusters, potentially including the rnf operon

    • Competent V. cholerae acquire DNA in a T6SS-dependent manner from killed neighbors

  • Recombination frequency:

    • Environmental V. cholerae populations show a recombination to mutation ratio (ρ/θ) of approximately 6.5:1

    • This high rate suggests that genes like rnfE could be frequently exchanged between strains

    • Recombination events were identified in environmental V. cholerae with an average exchange of more than 50 kbp or ~50 genes

To analyze rnfE distribution patterns, researchers should combine comparative genomics, phylogenetic analyses, and population genetic approaches to identify potential horizontal transfer events and their impact on functional diversity.

What techniques are most effective for analyzing recombination events involving the rnfE gene?

Based on successful approaches with V. cholerae , several complementary methods can effectively detect and characterize recombination involving genes like rnfE:

  • Computational detection methods:

    • Multiple detection algorithms should be employed simultaneously (e.g., RDP, GENECONV, BootScan, MaxChi)

    • In V. cholerae studies, 76 recombination events were identified by multiple detection methods

    • Using multiple methods increases confidence that detected patterns represent genuine recombination events

  • Phylogenetic approaches:

    • Analysis of topological incongruence between gene trees

    • Split-decomposition analysis to visualize conflicting phylogenetic signals

    • Incongruent but nonrandom associations were observed for maximum likelihood topologies from individual loci in V. cholerae

  • Population genetics methods:

    • Calculation of linkage disequilibrium (LD)

    • Analysis of single nucleotide polymorphism (SNP) distribution patterns

    • Population recombination rate estimation using LDhat software

  • Experimental validation:

    • Natural transformation assays

    • Long-read sequencing to detect large recombination fragments

    • V. cholerae can acquire DNA fragments with lengths exceeding 150 kbp in a T6SS-dependent manner

The integration of these approaches provides robust evidence for recombination events and their evolutionary significance in the diversification of electron transport systems in V. cholerae.

How do genomic islands impact the evolution of electron transport systems in V. cholerae?

Genomic islands (GIs) significantly influence the evolution of bacterial gene systems, including electron transport complexes. Their impact on systems like RnfE may include:

  • Functional adaptation:

    • GIs often carry genes that enable adaptation to specific environmental challenges

    • Acquisition of novel electron transport components could allow exploitation of new ecological niches

    • V. cholerae has diversified through sequential acquisition of mobile genetic elements, likely driven by environmental factors

  • Regulatory integration:

    • Horizontally acquired genes must integrate into existing regulatory networks

    • This can create novel expression patterns for electron transport systems

    • Mobile genetic elements may carry their own regulatory systems that interact with core genome regulators

  • Genomic context effects:

    • Insertion of GIs can disrupt existing operons or create new gene clusters

    • This may lead to altered expression or novel functional associations

    • The genomic location of rnfE relative to mobile elements would influence its evolutionary trajectory

While the search results don't specifically address RnfE in relation to genomic islands, they highlight that important functional elements in V. cholerae, such as Vibrio pathogenicity island-1 (VPI-1) and Vibrio pathogenicity island-2 (VPI-2), are associated with mobile genetic elements . This suggests that electron transport systems could similarly be influenced by genomic islands, potentially contributing to metabolic diversity across V. cholerae strains.

What structural features are essential for RnfE function in electron transport?

Based on structural studies of related electron transport proteins such as Na+-NQR in V. cholerae , several structural features are likely critical for RnfE function:

  • Transmembrane architecture:

    • Multiple transmembrane helices forming channels or binding sites for ion translocation

    • Specific residues within these helices likely coordinate ion binding and transport

    • The spatial arrangement of these helices defines ion pathway and specificity

  • Cofactor coordination sites:

    • Binding motifs for iron-sulfur clusters that mediate electron transfer

    • Specific amino acid residues (typically cysteine) that coordinate the metal centers

    • Precise spatial positioning of cofactors to create efficient electron transfer pathways

  • Conformational switch elements:

    • Regions that undergo redox-dependent conformational changes

    • In Na+-NQR, the redox state of a unique intramembranous [2Fe-2S] cluster orchestrates conformational changes coupling electron transfer to ion translocation

    • Similar coupling mechanisms may exist in RnfE

  • Subunit interaction interfaces:

    • Specific surfaces mediating assembly of the complete Rnf complex

    • Conserved residues at these interfaces ensure proper complex formation

    • Dynamic interactions that may change during the catalytic cycle

To identify these features experimentally, researchers should employ approaches similar to those used for Na+-NQR , including cryo-EM, X-ray crystallography, site-directed mutagenesis, and spectroscopic characterization of cofactors.

How do computational approaches contribute to understanding RnfE structure-function relationships?

Computational approaches offer valuable insights into RnfE structure-function relationships when experimental structural data is limited:

  • Homology modeling:

    • Generation of 3D models based on related proteins with known structures

    • Template identification through sensitive sequence alignment methods

    • Model refinement using energy minimization and molecular dynamics simulation

  • Protein-protein docking:

    • Prediction of interaction interfaces between RnfE and other Rnf complex subunits

    • Algorithms like HADDOCK, ClusPro, or Rosetta can generate plausible complex models

    • Integration with experimental constraints (e.g., cross-linking data) improves accuracy

  • Molecular dynamics simulations:

    • Simulation of RnfE behavior in a membrane environment

    • Investigation of conformational changes similar to those observed in Na+-NQR

    • Identification of water/ion pathways and gating mechanisms

  • Evolutionary coupling analysis:

    • Identification of co-evolving residue pairs that likely interact in the folded structure

    • Methods like Direct Coupling Analysis (DCA) can predict contacts from sequence data alone

    • These predictions can guide experimental design for site-directed mutagenesis

For RnfE specifically, computational approaches would be particularly valuable for predicting transmembrane topology, identifying potential cofactor binding sites, and understanding how electron transfer might be coupled to ion translocation through conformational changes.

What structural differences distinguish RnfE from homologous proteins in other bacterial pathogens?

Comparing RnfE to homologous proteins in other bacterial pathogens reveals important structural and functional distinctions:

  • Subunit composition and arrangement:

    • While the core Rnf complex architecture is generally conserved across bacteria, specific adaptations may occur in V. cholerae

    • These adaptations could reflect the unique environmental pressures faced by this pathogen

    • The arrangement of subunits might differ from those in non-pathogenic bacteria or other pathogens

  • Cofactor differences:

    • The number, type, and arrangement of iron-sulfur clusters may vary

    • These differences influence electron transfer properties including redox potentials and rates

    • Comparison with the unique cofactor arrangement in Na+-NQR would be particularly informative

  • Ion specificity determinants:

    • Residues lining putative ion channels define ion selectivity (Na+ vs. H+)

    • Given V. cholerae's adaptation to both marine and host environments, it may have unique ion handling properties

    • Comparative analysis could identify key residues determining these specificities

  • Regulatory interfaces:

    • Surfaces interacting with V. cholerae-specific regulatory proteins

    • These interactions may tie electron transport to virulence regulation

    • Pathogen-specific structural features might enable integration of metabolic and virulence networks

Structural analysis through comparative modeling and experimental approaches would reveal these distinctions, potentially identifying unique features that could be targeted for pathogen-specific inhibition.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.