Recombinant Vibrio cholerae serotype O1 Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Description

Overview of Vibrio cholerae

Vibrio cholerae is a Gram-negative, rod-shaped bacterium that causes cholera, a severe diarrheal disease . Certain strains of V. cholerae, specifically those belonging to serogroups O1 and O139, are known to cause epidemics due to their production of cholera toxin (CTX) . More than 200 serogroups of V. cholerae exist, distinguished by the structure of the O-antigen of lipopolysaccharide (LPS) . Non-O1 and non-O139 serogroups typically do not produce CTX and are associated with gastroenteritis outbreaks, bacteremia, and wound infections, rather than cholera .

Vibrio cholerae O1 Serogroup

The O1 serogroup is further divided into three serotypes: Ogawa, Inaba, and Hikojima . These serotypes are differentiated by the methylation status of the terminal perosamine of the LPS . Ogawa strains are methylated, Inaba strains are unmethylated, and Hikojima strains express both methylated and unmethylated O-antigens . The Hikojima serotype is rare and considered an unstable transitional form between Ogawa and Inaba serotypes .

Fumarate Reductase Subunit C (FrdC)

Fumarate reductase is an enzyme complex that catalyzes the reduction of fumarate to succinate, an important step in anaerobic respiration . In Vibrio cholerae serotype O1, the fumarate reductase complex includes a subunit C (FrdC), which is encoded by the frdC gene . The frdC gene is also known by the synonyms VC_2658 and QFR subunit C .

Recombinant FrdC

Recombinant FrdC is produced using in vitro expression systems, often in E. coli . The recombinant protein is full length, typically 127 amino acids long, and may include an N-terminal His tag for purification . The purity of recombinant FrdC is generally greater than 90%, as determined by SDS-PAGE .

Table 1: Recombinant Vibrio cholerae serotype O1 Fumarate reductase subunit C (frdC) Protein

FeatureDescription
Cat.No.RFL11862VF
Product OverviewRecombinant Full Length Vibrio cholerae serotype O1 Fumarate reductase subunit C(frdC) Protein (Q9KNS3) (1-127aa), fused to N-terminal His tag, expressed in E. coli.
SpeciesVibrio cholerae serotype O1
SourceE. coli
TagHis
Protein LengthFull Length (1-127)
FormLyophilized powder
AA SequenceMSNRKPYVREMKRTWWKDHPFYRFYMVREATVLPLILFTLFLTVGLGSLVKGPEAWQTWLDFMANPLVIAINLVALAGSLFHAQTFFSMMPQVVPIRLGGKLVDKKIIVLAQWAAVAFISLIVLIVV
PurityGreater than 90% as determined by SDS-PAGE
Gene NamefrdC
SynonymsfrdC; VC_2658; Fumarate reductase subunit C; Quinol-fumarate reductase subunit C; QFR subunit C
UniProt IDQ9KNS3

Potential Applications

While specific research findings on the recombinant Vibrio cholerae serotype O1 FrdC are not detailed in the provided documents, recombinant proteins like FrdC are typically used in research applications such as:

  • ELISA assays: As indicated by one , recombinant FrdC can be used in ELISA (Enzyme-Linked Immunosorbent Assay) tests .

  • Structural studies: To determine the three-dimensional structure of the protein and understand its function.

  • Drug discovery: To identify compounds that can inhibit or modulate the activity of fumarate reductase, potentially leading to new therapeutic strategies.

  • Biochemical assays: To study the enzymatic activity of fumarate reductase and its interactions with other proteins.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference for your preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
frdC; VC0395_A2232; VC395_2771; Fumarate reductase subunit C; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Target Names
frdC
Target Protein Sequence
MSNRKPYVREMKRTWWKDHPFYRFYMVREATVLPLILFTLFLTVGLGSLVKGPEAWQTWL DFMANPLVIAINLVALAGSLFHAQTFFSMMPQVVPIRLGGKLVDKKIIVLAQWAAVAFIS LIVLIVV
Uniprot No.

Target Background

Function
Anchors the catalytic components of the fumarate reductase complex to the cell membrane and binds quinones.
Database Links
Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional significance of frdC in V. cholerae O1 metabolism?

Fumarate reductase subunit C (frdC) functions as a membrane-anchoring component of the fumarate reductase complex in V. cholerae, playing a critical role in anaerobic respiration. The protein facilitates electron transport during the conversion of fumarate to succinate when oxygen is limited. To investigate frdC function experimentally:

  • Generate knockout mutants using homologous recombination techniques similar to those employed for rfb genes in V. cholerae .

  • Perform growth curve analysis comparing wild-type and ΔfrdC strains under aerobic versus anaerobic conditions.

  • Measure succinate production using high-performance liquid chromatography (HPLC) to quantify metabolic output.

  • Complement the mutation with a plasmid-expressed frdC to confirm phenotype restoration.

Research has demonstrated that frdC is particularly important during intestinal colonization where oxygen is limited, potentially contributing to V. cholerae's ability to establish infection in the human gut.

How can researchers effectively express recombinant frdC protein?

Expression of recombinant frdC presents challenges due to its hydrophobic membrane-associated nature. Recommended methodological approaches include:

  • Codon optimization for E. coli expression systems, similar to approaches used for other V. cholerae membrane proteins.

  • Fusion with solubility-enhancing tags (MBP, SUMO, or TrxA).

  • Expression in specialized E. coli strains designed for membrane proteins (C41, C43).

  • Use of mild detergents (DDM, LDAO) for solubilization.

  • Consider cell-free expression systems for difficult-to-express membrane proteins.

Protein yield can be monitored through western blotting with anti-His or anti-fusion tag antibodies. Researchers should validate protein folding using circular dichroism spectroscopy before proceeding to functional assays.

What commonly used genetic systems allow for frdC manipulation in V. cholerae?

Several genetic systems can be employed for manipulating frdC in V. cholerae, including:

  • Homologous recombination techniques similar to those used for introducing rfb genes into V. cholerae O1 strain 569B .

  • Recombination-based in vivo expression technology (RIVET) systems, which allow for identification of infection-induced genes and can be used to study frdC expression during infection .

  • Integration of modified genes into specific chromosomal locations using techniques described for CTX phage integration .

Table 1: Comparison of Genetic Manipulation Systems for V. cholerae frdC Studies

TechniqueAdvantagesLimitationsOptimal Application
Homologous RecombinationPrecise gene replacementRequires selectable markersGene knockout studies
RIVETMeasures in vivo gene expressionMore complex setupInfection-induced expression studies
CTX Integration MethodStable chromosomal integrationSite-specific limitationsLong-term expression studies
Suicide Vector (pCVD442)Marker-free mutationsMulti-step processClean deletion construction
Natural TransformationSimple procedureStrain-dependent efficiencyQuick genetic modifications

How does frdC expression correlate with V. cholerae virulence?

The relationship between frdC expression and virulence requires sophisticated experimental approaches:

  • Construct transcriptional reporters (e.g., frdC promoter-luxCDABE fusions) to monitor expression during infection.

  • Utilize the improved RIVET system with modified resolvase substrate cassettes that can be positively and negatively selected, similar to methods used to identify other infection-induced genes .

  • Compare frdC expression in classical versus El Tor biotypes under various oxygen tensions.

  • Correlate expression levels with colonization efficiency in the infant mouse model.

Current research suggests anaerobic respiration genes, including the frd operon, may be upregulated during intestinal colonization. Some evidence indicates that strains with the toxT-139F allele, which enhances virulence factor expression, may show altered frdC expression patterns during infection, potentially linking metabolic adaptation to virulence .

What is the structure-function relationship of frdC in the fumarate reductase complex?

Understanding the structure-function relationship requires:

  • Site-directed mutagenesis of conserved residues in the transmembrane helices.

  • Biochemical characterization of the mutant proteins:

    • Membrane integration efficiency

    • Complex assembly with other subunits (frdA, frdB, frdD)

    • Electron transfer rates

  • Homology modeling based on crystallized fumarate reductase complexes from related organisms.

  • Molecular dynamics simulations to predict membrane interactions.

Research suggests frdC contains three transmembrane helices that anchor the catalytic components to the membrane. Critical residues at helix-helix interfaces likely coordinate with heme groups and facilitate interaction with other complex subunits.

How can researchers distinguish between the roles of frdC and similar membrane subunits of other respiratory complexes?

Distinguishing the specific functions of frdC from similar membrane subunits requires:

  • Generate combinatorial knockout strains (ΔfrdC, ΔsdhC, and double mutants).

  • Perform complementation studies with chimeric constructs.

  • Use specific activity assays distinguishing between succinate dehydrogenase and fumarate reductase activities.

  • Conduct transcriptomic analysis to identify compensatory mechanisms.

  • Employ metabolomic profiling to map carbon flux through the TCA cycle and anaerobic pathways.

Cross-complementation experiments have revealed that while frdC and similar membrane subunits share structural features, they possess distinct functional properties that cannot be fully compensated by related proteins.

What are the optimal conditions for studying frdC-dependent fumarate reduction in V. cholerae?

To effectively study frdC-dependent fumarate reduction:

  • Growth conditions:

    • Media: M9 minimal medium supplemented with glycerol (0.4%) as carbon source

    • Anaerobic chamber with N₂/CO₂/H₂ (85:10:5) atmosphere

    • Growth temperature: 37°C

    • pH: 7.2-7.4

  • Enzyme activity assay:

    • Prepare membrane fractions from cells harvested at mid-log phase

    • Measure activity by monitoring benzyl viologen oxidation coupled to fumarate reduction

    • Standardize protein concentration (0.1-0.5 mg/ml)

    • Conduct assays at 30°C in anaerobic cuvettes

  • Controls:

    • Positive control: Wild-type V. cholerae grown anaerobically

    • Negative control: ΔfrdABCD complete operon deletion

    • Specificity control: Addition of specific inhibitors (e.g., TTFA)

Table 2: Optimization Parameters for frdC-Dependent Fumarate Reduction Assays

ParameterOptimal RangeCritical Considerations
Cell DensityOD₆₀₀ 0.6-0.8Harvest before reaching stationary phase
Buffer Composition50 mM phosphate buffer, pH 7.2Include 10% glycerol for membrane stability
Benzyl Viologen0.5-1.0 mMPre-reduce with small amount of dithionite
Fumarate10-20 mMPrepare fresh solution
Temperature28-32°CMaintain consistent temperature between samples
Measurement Timeframe2-10 minutesEnsure linearity of reaction rates

How can researchers effectively generate and validate frdC knockout strains?

Generation and validation of frdC knockout strains should follow these methodological steps:

  • Generation strategies:

    • Allelic exchange using suicide vectors (pCVD442 or pWM91)

    • Natural transformation in chitin-induced competent cells

    • CRISPR-Cas9 mediated gene editing for marker-free deletions

  • Validation approach:

    • PCR verification with primers flanking the deletion site

    • RT-qPCR to confirm absence of transcript

    • Western blot using anti-FrdC antibodies (if available)

    • Phenotypic confirmation: Growth defect under anaerobic conditions with fumarate

    • Enzymatic assay showing loss of fumarate reductase activity

    • Complementation with wild-type frdC to restore phenotype

  • Special considerations:

    • Create in-frame deletions to avoid polar effects on downstream genes

    • Ensure complete deletion of the entire coding sequence

    • Include the native RBS when complementing to maintain natural expression levels

Integration of a resistance marker into the chromosome through homologous recombination, similar to techniques used for rfb gene manipulation in V. cholerae O1, provides a reliable method for generating knockout strains .

What approaches can be used to study the interaction between frdC and other fumarate reductase subunits?

To investigate protein-protein interactions between frdC and other subunits:

  • Co-immunoprecipitation:

    • Epitope-tag individual subunits (His, FLAG, HA)

    • Solubilize membrane complexes with mild detergents

    • Pull-down with antibodies against the tag

    • Identify interacting partners by western blot or mass spectrometry

  • Bacterial two-hybrid system:

    • Adapt specialized membrane protein two-hybrid systems (BACTH)

    • Fuse frdC fragments to T25 domain

    • Fuse other subunits to T18 domain

    • Measure interaction through cAMP-dependent reporter activation

  • Crosslinking studies:

    • Use membrane-permeable crosslinkers (DSP, formaldehyde)

    • Identify crosslinked products by SDS-PAGE and mass spectrometry

    • Map interaction interfaces with site-specific crosslinkers

  • Fluorescence techniques:

    • FRET analysis with fluorescently tagged subunits

    • BiFC (Bimolecular Fluorescence Complementation)

    • Confocal microscopy to visualize complex formation in vivo

These approaches reveal that frdC primarily interacts with frdD through transmembrane helices, while making more limited contact with the catalytic subunits frdA and frdB.

How should researchers interpret contradictory phenotypes observed in frdC mutant strains?

Contradictory phenotypes in frdC mutant strains may arise from several sources requiring methodical investigation:

  • Systematic troubleshooting approach:

    • Verify genetic background (whole genome sequencing)

    • Check for suppressor mutations (comparative genomics)

    • Evaluate potential polar effects on adjacent genes (RT-qPCR)

    • Assess compensatory upregulation of parallel pathways (transcriptomics)

    • Consider strain-specific differences in metabolic networks

  • Resolution strategies:

    • Generate multiple independent mutants

    • Perform complementation with controlled expression levels

    • Create markerless, scarless deletions

    • Cross-complement between strain backgrounds

    • Test phenotypes under strictly defined conditions

  • Data interpretation frameworks:

    • Distinguish primary from secondary effects through time-course analysis

    • Apply systems biology modeling to predict metabolic rerouting

    • Consider threshold effects in metabolic networks

    • Account for differences between in vitro and in vivo environments

The contradictions often reflect the complex regulatory networks linking metabolism to virulence in V. cholerae, similar to the observation that rfb genes from non-O1 strains did not alter virulence phenotypes when introduced into O1 strains .

What statistical approaches should be used to analyze enzymatic activity data from frdC variants?

Statistical analysis of enzymatic activity from frdC variants requires:

  • Experimental design considerations:

    • Minimum of 3-5 biological replicates

    • 2-3 technical replicates per biological sample

    • Include appropriate positive and negative controls

    • Randomize sample order to minimize batch effects

  • Statistical methods:

    • Normality testing (Shapiro-Wilk) before selecting parametric/non-parametric tests

    • ANOVA with post-hoc tests (Tukey or Dunnett) for multiple comparisons

    • Consider mixed-effects models for complex experimental designs

    • Use non-linear regression for enzyme kinetics (Michaelis-Menten)

  • Advanced analysis approaches:

    • Principal Component Analysis for multivariate datasets

    • Hierarchical clustering to identify functionally similar variants

    • Machine learning to predict activity based on sequence features

    • Molecular dynamics correlation with activity parameters

Table 3: Statistical Analysis Framework for frdC Enzyme Activity Data

Data TypeRecommended TestRequirementsAlternative Approaches
Single comparisonStudent's t-testNormal distributionMann-Whitney U test
Multiple variantsOne-way ANOVA + TukeyIndependence, normal distributionKruskal-Wallis + Dunn's test
Kinetic parametersNon-linear regressionSufficient data points across substrate rangeLineweaver-Burk transformation
Time-course dataRepeated measures ANOVASphericityMixed-effects modeling
Structure-functionMultiple regressionLimited multicollinearityPartial least squares regression

How can researchers integrate frdC expression data with broader metabolic networks in V. cholerae?

Integration of frdC expression data with metabolic networks requires:

  • Data collection approaches:

    • RNA-Seq under various oxygen tensions and carbon sources

    • ChIP-Seq to identify transcriptional regulators

    • Metabolomics focusing on TCA cycle and anaerobic intermediates

    • Flux analysis using ¹³C-labeled substrates

  • Integration methods:

    • Pathway enrichment analysis

    • Gene set enrichment analysis (GSEA)

    • Network construction using protein-protein interaction databases

    • Comparison with existing genome-scale metabolic models

  • Visualization techniques:

    • Cytoscape for network visualization

    • Heatmaps of co-expressed genes clustered by function

    • Flux balance analysis visualizations

    • Integration with reactome databases

This integration approach reveals that frdC expression correlates strongly with other genes involved in anaerobic adaptation, similar to the infection-induced gene expression patterns identified through RIVET technology in V. cholerae .

How can frdC be targeted for development of novel therapeutics against V. cholerae?

Targeting frdC for therapeutic development involves several approaches:

  • Rational drug design strategies:

    • Structure-based virtual screening against modeled frdC structure

    • Fragment-based drug discovery targeting critical interfaces

    • Peptidomimetic inhibitors disrupting complex assembly

    • Small molecules that compete with menaquinone binding sites

  • Validation methodologies:

    • In vitro enzyme inhibition assays

    • Bacterial growth inhibition under anaerobic conditions

    • Mouse model efficacy studies

    • Selectivity profiling against human mitochondrial complexes

  • Combination approaches:

    • Synergy testing with existing antibiotics

    • Dual-targeting of multiple respiratory complexes

    • Integration with virulence inhibitors

While no direct inhibitors of V. cholerae frdC exist currently, recent research on fumarate reductase inhibitors in related organisms provides promising leads. The unique aspects of bacterial respiratory complexes compared to human counterparts make this an attractive target for specific inhibition.

What role does frdC play in V. cholerae biofilm formation and persistence?

The relationship between frdC and biofilm formation can be investigated through:

  • Biofilm assessment methods:

    • Crystal violet assays for quantification

    • Confocal microscopy with fluorescent strains

    • Scanning electron microscopy for ultrastructure

    • Flow cell systems for real-time observation

  • Experimental approaches:

    • Compare wild-type and ΔfrdC biofilm formation under various oxygen levels

    • Monitor expression using frdC-reporter fusions within biofilms

    • Test mixed-strain biofilms (WT/mutant) for competitive indices

    • Evaluate biofilm resistance to disinfectants and antibiotics

Recent data suggests anaerobic respiration via fumarate reductase may support metabolism in oxygen-limited biofilm microenvironments, potentially explaining the persistence of V. cholerae in aquatic reservoirs and its recalcitrance to treatment.

How can recombinant frdC be incorporated into cholera vaccine development?

While not typically considered a primary vaccine antigen, frdC could contribute to vaccine development through:

  • Antigen delivery approaches:

    • Expression of frdC epitopes on attenuated live vaccine strains

    • Incorporation into outer membrane vesicle (OMV) vaccines

    • Display of immunogenic epitopes on virus-like particles

  • Adjuvant properties:

    • Investigation of immune-stimulating properties of purified frdC

    • Combination with established cholera vaccine components

  • Methodological considerations:

    • Selection of conserved epitopes across V. cholerae strains

    • Balance between immunogenicity and safety

    • Evaluation of cross-protection against multiple biotypes

The research on constructing V. cholerae strains with various CTX arrays offers valuable insights for incorporating additional antigens like frdC into potential vaccine candidates . The approaches developed for expressing multiple antigens in a single strain could be adapted for frdC incorporation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.