Recombinant Vibrio cholerae serotype O1 Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
frdD; VCM66_2579; Fumarate reductase subunit D; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-130
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain M66-2)
Target Names
frdD
Target Protein Sequence
MFLLWCKELIVINTNPKRSDEPVWWSLFGAGGTWFAMITPITVLVLGILAPLGVIDAEAL SYERVSSFATSIIGALFIIGTLALPMWHAMHRVHHGMHDLKFHTGVAGKIACYGFATIIS ALAVVFIFMI
Uniprot No.

Target Background

Function
Anchors the catalytic components of the fumarate reductase complex to the cell membrane and binds quinones.
Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Fumarate reductase in V. cholerae?

Fumarate reductase in V. cholerae is a membrane-bound complex composed of four polypeptides designated FrdA, FrdB, FrdC, and FrdD (encoded by genes VC2656-2659). The catalytic FrdAB components face the inner side of the cytoplasmic membrane, where fumarate is reduced to succinate, while FrdC and FrdD are integral membrane proteins that anchor the complex to the cytoplasmic membrane . The FrdD subunit specifically contributes to the membrane anchoring of the complex and participates in electron transfer pathways during anaerobic respiration.

What is the functional significance of FrdD in V. cholerae metabolism?

FrdD functions as an essential component of the fumarate reductase complex, which catalyzes the reduction of fumarate to succinate during anaerobic respiration. This process is crucial for V. cholerae survival under oxygen-limited conditions, such as those found in the human intestine during infection. Fumarate respiration represents one of the most extensive forms of anaerobic respiration in V. cholerae, allowing the pathogen to maintain energy production in hypoxic environments . This metabolic versatility contributes significantly to the bacterium's pathogenesis and environmental persistence.

How does fumarate reductase activity contribute to V. cholerae pathogenesis?

The fumarate reductase complex enables V. cholerae to efficiently colonize the human intestine by supporting growth under the low-oxygen conditions encountered during infection. This metabolic adaptation contributes to the bacterium's virulence by:

  • Sustaining energy production during intestinal colonization

  • Supporting bacterial persistence in hypoxic microenvironments

  • Potentially contributing to antibiotic resistance mechanisms

  • Enabling adaptation to varying oxygen levels during infection progression

While the exact role of fumarate respiration in colonization during infection is not fully elucidated, respiratory enzymes are known to be essential for pathogenic bacteria including V. cholerae, sustaining metabolism and in some cases supporting antibiotic-resistance development .

What distinguishes FrdD from other Fumarate reductase subunits?

SubunitMolecular FunctionCellular LocationDistinctive Features
FrdACatalytic activity (FAD binding)Membrane-associated (cytoplasmic face)Contains the active site for fumarate reduction
FrdBElectron transfer (Fe-S clusters)Membrane-associated (cytoplasmic face)Contains iron-sulfur clusters for electron transfer
FrdCMembrane anchoring, quinol interactionIntegral membrane proteinContains heme groups for electron transfer
FrdDMembrane anchoring, stabilityIntegral membrane proteinSmallest subunit; enhances complex stability and assembly

FrdD is distinguished by its role in membrane anchoring and complex stability. Unlike the catalytic subunits, it does not directly participate in the redox reaction but is crucial for proper complex assembly and membrane integration .

What bioinformatic tools are recommended for analyzing FrdD sequences?

For comprehensive analysis of V. cholerae FrdD sequences, researchers should employ:

  • Sequence alignment tools: MUSCLE or Clustal Omega for multiple sequence alignment to identify conserved regions across different V. cholerae strains

  • Structural prediction tools: SWISS-MODEL or Phyre2 for tertiary structure prediction

  • Transmembrane domain analysis: TMHMM or HMMTOP to identify membrane-spanning regions

  • Phylogenetic analysis: MEGA X for evolutionary studies

  • Protein-protein interaction prediction: STRING database to analyze potential interactions with other fumarate reductase subunits

These analyses can reveal conserved domains, functional motifs, and evolutionary relationships of FrdD across different bacterial species, providing insights into its functional significance .

How does oxygen availability regulate the expression of the frdABCD operon in V. cholerae?

In V. cholerae, similar regulatory mechanisms likely exist, but with pathogen-specific adaptations. Research indicates that:

  • Oxygen-sensing transcription factors likely regulate frdABCD expression

  • Environmental factors such as nitrate availability may influence regulation

  • The DcuSR regulatory two-component system may respond to exogenous fumarate

  • Unlike nitrate respiration, TMAO does not appear to hierarchically regulate fumarate reductase gene expression

Researchers investigating this area should consider chromatin immunoprecipitation sequencing (ChIP-seq) and transcriptome analysis to identify regulatory elements controlling frdABCD expression under various oxygen conditions.

What post-translational modifications occur in FrdD and how do they impact enzyme function?

Post-translational modifications (PTMs) of FrdD remain underexplored but may significantly impact fumarate reductase function. While specific PTMs of FrdD have not been thoroughly characterized, research on related respiratory enzymes suggests potential modifications including:

  • Phosphorylation: May regulate enzyme activity or protein-protein interactions

  • Lipid modifications: Could enhance membrane association and stability

  • Disulfide bond formation: May affect protein folding and stability

Of particular interest is the potential role of covalent flavin attachment. Although FrdD itself may not directly bind flavin, the fumarate reductase complex contains flavin cofactors that can form covalent bonds. This type of covalent attachment has been observed in other membrane-bound respiratory enzymes in V. cholerae and related species . Investigating PTMs requires mass spectrometry-based proteomics approaches, including enrichment strategies for specific modifications.

How do genetic variations in frdD across V. cholerae strains correlate with pathogenicity?

Genetic variations in the frdD gene across different V. cholerae strains may contribute to differences in pathogenicity and environmental adaptation. Recent genomic analyses of V. cholerae isolates reveal significant genetic diversity , which likely extends to the frdABCD operon.

Comparative genomics studies should examine:

  • Single nucleotide polymorphisms (SNPs) in frdD across classical, El Tor, and atypical biotypes

  • Correlation between frdD variants and clinical outcomes in cholera patients

  • Association between specific frdD alleles and environmental persistence

  • Potential horizontal gene transfer events affecting the frdABCD operon

A comprehensive analysis of frdD sequences from the expanding AFR12 and AFR15 O1 lineages could reveal evolutionary adaptations related to metabolic fitness in different environments . Such studies would require whole-genome sequencing data from diverse isolates and sophisticated bioinformatic analyses to correlate genetic variations with phenotypic differences.

What is the interplay between FrdD and antimicrobial resistance mechanisms in V. cholerae?

The potential relationship between fumarate reductase activity and antimicrobial resistance (AMR) in V. cholerae represents an emerging research area. Recent studies indicate high resistance to trimethoprim (96%) and quinolones (83%) among V. cholerae isolates, while resistance to azithromycin, rifampicin, and tetracycline remains relatively low .

The FrdD subunit may contribute to AMR through several mechanisms:

  • Metabolic flexibility: Enabling bacterial survival under antibiotic stress by maintaining energy production via alternative respiratory pathways

  • Membrane composition alterations: FrdD's membrane association may influence permeability to antibiotics

  • Stress response coordination: Fumarate reductase activity may be linked to general stress response mechanisms that confer drug tolerance

Research approaches should include:

  • Construction of frdD deletion mutants to assess changes in antibiotic susceptibility

  • Transcriptomic analysis comparing wild-type and frdD mutants under antibiotic exposure

  • Biochemical characterization of membrane properties in strains with altered FrdD expression

Understanding this interplay could inform new strategies to combat V. cholerae infections in the face of increasing antimicrobial resistance .

How does the interaction between FrdD and other membrane proteins affect V. cholerae metabolism?

FrdD likely participates in a complex network of protein-protein interactions within the bacterial membrane, affecting various aspects of V. cholerae metabolism. As an integral membrane protein, FrdD may interact with:

  • Respiratory chain components: Including other dehydrogenases and reductases

  • Transport proteins: Such as the BtuD ATP-binding protein involved in vitamin B12 import

  • Membrane structural proteins: Affecting membrane organization and integrity

These interactions may create respiratory supercomplexes that enhance electron transfer efficiency or channel metabolic intermediates. Research approaches to investigate these interactions should include:

  • Membrane protein co-immunoprecipitation followed by mass spectrometry

  • Bacterial two-hybrid assays adapted for membrane proteins

  • Fluorescence resonance energy transfer (FRET) studies with fluorescently labeled proteins

  • Crosslinking studies to capture transient interactions

Understanding these interactions could reveal how V. cholerae coordinates its metabolism under different environmental conditions, potentially identifying new targets for antimicrobial intervention.

What are the optimal conditions for expressing recombinant V. cholerae FrdD in heterologous systems?

Successful expression of recombinant V. cholerae FrdD requires careful optimization due to its membrane-embedded nature. Based on experimental evidence and related membrane protein expression systems, the following conditions are recommended:

Expression SystemRecommended StrainInduction ConditionsTemperatureMedia SupplementsYield Optimization
E. coliC41(DE3) or C43(DE3)0.1-0.5 mM IPTG18-22°C1% glucose pre-inductionCo-expression with chaperones
Yeast (S. cerevisiae)GS115 or BJ5464Methanol induction (0.5%)25-30°CErgosterol supplementsFusion with GFP for stability
BaculovirusSf9 or High FiveMOI 2-5, 72h27°CLipid supplementsSignal peptide optimization
Mammalian cellsHEK293 or CHOTetracycline-inducible37°CSodium butyrate (5 mM)Stable cell line development

Key considerations include:

  • Using low induction temperatures to slow protein synthesis and promote proper folding

  • Adding detergents during purification (recommended: n-Dodecyl β-D-maltoside at 1%)

  • Including stabilizing agents such as glycerol (10-20%) in purification buffers

  • Considering co-expression with other Frd subunits for enhanced stability

For isotopic labeling studies, minimal media with 15N-ammonium sulfate and 13C-glucose can be used with reduced expression temperatures to maintain proper folding.

What purification strategies yield the highest activity for recombinant FrdD protein?

Purifying active recombinant FrdD presents challenges due to its hydrophobic nature and membrane association. A multi-step purification strategy is recommended:

  • Membrane preparation:

    • Harvest cells and disrupt by French press (15,000 psi) or sonication

    • Separate membranes by ultracentrifugation (100,000 × g, 1 hour, 4°C)

    • Wash membranes with high salt buffer (300 mM NaCl) to remove peripheral proteins

  • Solubilization:

    • Solubilize membranes in buffer containing 1-2% n-Dodecyl β-D-maltoside (DDM) or 1% digitonin

    • Include protease inhibitors and 10% glycerol

    • Incubate with gentle agitation at 4°C for 1-2 hours

  • Affinity purification:

    • For His-tagged constructs, use Ni-NTA resin with 0.05% DDM in all buffers

    • Wash extensively with 20-40 mM imidazole

    • Elute with 250-300 mM imidazole

  • Size exclusion chromatography:

    • Use Superdex 200 column with 0.03% DDM in running buffer

    • Collect fractions corresponding to the expected molecular weight

    • Verify protein identity by mass spectrometry

For functional studies, consider co-purification with other Frd subunits, as the complete complex is likely to exhibit the highest enzymatic activity .

What assays can effectively measure FrdD incorporation into functional fumarate reductase complexes?

Several complementary approaches can assess FrdD incorporation into functional fumarate reductase complexes:

  • Enzyme activity assays:

    • Measure fumarate reduction using benzyl viologen as electron donor

    • Monitor decrease in absorbance at 578 nm as benzyl viologen is oxidized

    • Calculate specific activity (μmol fumarate reduced/min/mg protein)

  • Blue Native PAGE:

    • Separate intact membrane protein complexes under non-denaturing conditions

    • Perform western blotting using antibodies against different Frd subunits

    • Verify co-migration of all subunits at the expected molecular weight

  • Co-immunoprecipitation:

    • Use antibodies against one subunit to pull down the entire complex

    • Analyze composition by SDS-PAGE and western blotting

    • Confirm presence of all four subunits in stoichiometric ratios

  • Fluorescence-based approaches:

    • Label FrdD with a fluorescent tag

    • Measure FRET when co-expressed with differently labeled Frd subunits

    • Quantify complex formation through fluorescence correlation spectroscopy

  • Membrane fractionation:

    • Separate inner and outer membranes using sucrose gradient ultracentrifugation

    • Analyze fumarate reductase activity in different fractions

    • Confirm proper localization to the inner membrane

These assays provide comprehensive evidence of functional incorporation by assessing complex formation, correct localization, and enzymatic activity .

How can researchers generate V. cholerae strains with modified frdD for structure-function studies?

To generate V. cholerae strains with modified frdD for structure-function studies, researchers can employ several genetic engineering approaches:

  • Allelic exchange mutagenesis:

    • Design suicide vectors containing modified frdD flanked by homologous regions

    • Introduce into V. cholerae through conjugation or electroporation

    • Select for double crossover events using counterselectable markers (e.g., sacB)

    • Verify integration by PCR and sequencing

  • CRISPR-Cas9 genome editing:

    • Design guide RNAs targeting the frdD locus

    • Provide repair template containing desired modifications

    • Introduce system through conjugative plasmids

    • Screen for successful editing by phenotypic assays and sequencing

  • Recombineering approaches:

    • Express lambda Red recombination proteins in V. cholerae

    • Introduce linear DNA fragments containing modified frdD

    • Select for recombinants using appropriate markers

For specific modifications, consider:

  • Alanine scanning to identify essential residues

  • Introduction of fluorescent protein fusions for localization studies

  • Addition of affinity tags for protein interaction studies

  • Conservative substitutions to probe specific amino acid functions

To confirm successful modification, characterize strains by:

  • Whole genome sequencing to verify modification and detect off-target effects

  • Growth curves under aerobic versus anaerobic conditions

  • Enzymatic assays to assess fumarate reductase activity

  • Transcriptional analysis to confirm normal expression levels

What experimental designs best evaluate the role of FrdD in V. cholerae pathogenesis?

To comprehensively evaluate FrdD's role in V. cholerae pathogenesis, a multi-faceted experimental approach is recommended:

  • Construction of isogenic mutants:

    • Generate clean frdD deletion mutants

    • Complement with wild-type and modified frdD alleles

    • Include strains with mutations in other frd subunits for comparison

  • In vitro characterization:

    • Assess growth under aerobic, microaerobic, and anaerobic conditions

    • Measure biofilm formation capacity

    • Evaluate resistance to acid, bile, and oxidative stress

    • Determine minimal inhibitory concentrations for various antibiotics

  • Cell culture models:

    • Quantify adherence and invasion of intestinal epithelial cells

    • Measure transepithelial electrical resistance to assess barrier disruption

    • Analyze host cell cytokine responses

    • Perform competitive index assays between wild-type and mutant strains

  • Animal models:

    • Infant mouse colonization model

    • Adult rabbit ileal loop model for fluid accumulation

    • Drosophila infection model for high-throughput screening

    • Competitive colonization assays using differentially marked strains

  • Transcriptomic and proteomic analyses:

    • RNA-seq to identify differentially expressed genes in frdD mutants

    • Proteomics to assess changes in membrane protein composition

    • Metabolomics to evaluate shifts in central metabolism

These approaches should be conducted using both classical and El Tor biotypes to account for strain-specific differences in pathogenesis mechanisms .

How should researchers analyze evolving FrdD sequences in emerging V. cholerae variants?

For comprehensive analysis of evolving FrdD sequences in emerging V. cholerae variants, researchers should implement a multi-level analytical framework:

  • Sequence conservation analysis:

    • Calculate conservation scores for each amino acid position

    • Identify hypervariable versus conserved regions

    • Generate sequence logos to visualize conservation patterns

    • Compare conservation between membrane-spanning and cytoplasmic domains

  • Selection pressure analysis:

    • Calculate dN/dS ratios to detect positive or purifying selection

    • Implement PAML or HyPhy tools for codon-based selection analysis

    • Identify specific codons under selection pressure

    • Compare selection patterns between pandemic and environmental isolates

  • Structural impact prediction:

    • Map variants onto predicted 3D structures

    • Assess changes in hydrophobicity, charge, or size

    • Predict effects on transmembrane helix stability

    • Evaluate impacts on protein-protein interaction interfaces

  • Functional correlation analysis:

    • Correlate sequence variations with phenotypic data

    • Analyze associations with antimicrobial resistance profiles

    • Compare variants from different geographic regions

    • Assess temporal patterns in sequence evolution

  • Network analysis:

    • Construct co-evolution networks with other Frd subunits

    • Identify compensatory mutations across the complex

    • Analyze epistatic interactions between variants

This approach has revealed significant genetic diversity in African V. cholerae isolates, with expanding AFR12 and AFR15 clades showing distinctive evolutionary patterns .

How can structural predictions of FrdD inform the design of inhibitors targeting fumarate reductase?

Structural predictions of FrdD can guide rational design of inhibitors targeting the fumarate reductase complex through several approaches:

  • Membrane interface targeting:

    • Identify FrdD residues at the interface with catalytic subunits

    • Design molecules that disrupt critical protein-protein interactions

    • Focus on regions unique to bacterial versus human respiratory complexes

  • Transmembrane channel analysis:

    • Predict quinone binding sites at the interface of FrdC and FrdD

    • Design competitive inhibitors that block electron transfer

    • Exploit differences in quinone specificity between bacterial and human enzymes

  • Allosteric site identification:

    • Use computational approaches to identify allosteric pockets

    • Design molecules that lock the complex in inactive conformations

    • Target sites that affect complex assembly or stability

  • Structure-based virtual screening:

    • Develop homology models based on related crystal structures

    • Perform virtual screening of compound libraries against predicted binding sites

    • Prioritize compounds with favorable binding energies for experimental validation

  • Fragment-based drug design:

    • Identify small molecules that bind to different regions of FrdD

    • Link fragments to create high-affinity, specific inhibitors

    • Optimize for membrane permeability and stability

These approaches could lead to novel antimicrobials specifically targeting fumarate reductase, potentially addressing resistance mechanisms associated with conventional antibiotics .

What bioinformatic approaches can predict the functional impact of FrdD variants identified in clinical isolates?

To predict the functional impact of FrdD variants from clinical isolates, researchers should employ a comprehensive bioinformatic pipeline:

  • Variant effect prediction tools:

    • SIFT and PolyPhen-2 for evolutionary conservation-based predictions

    • PROVEAN for protein variation effect analysis

    • MutPred for prediction of pathogenic mutations

    • Custom algorithms trained on bacterial membrane protein datasets

  • Structural impact assessment:

    • SWISS-MODEL for homology modeling of variants

    • FoldX for calculation of stability changes (ΔΔG)

    • DUET for integrated prediction of stability changes

    • MD simulations to assess dynamic effects of mutations

  • Functional domain analysis:

    • InterProScan to identify conserved domains and motifs

    • Transmembrane topology prediction using TMHMM and TOPCONS

    • Identification of critical residues through multiple sequence alignment

    • Assessment of changes in post-translational modification sites

  • System-level impact prediction:

    • Protein-protein interaction network analysis

    • Metabolic modeling to predict effects on bacterial growth

    • Integration with transcriptomic data from clinical isolates

    • Machine learning approaches trained on phenotype-genotype correlations

  • Evolutionary context analysis:

    • Calculation of evolutionary rates at each position

    • Identification of co-evolving residues within the protein

    • Comparison with variants in related bacterial species

    • Assessment of natural selection patterns

These approaches can help prioritize variants for experimental validation and identify potentially significant mutations in newly sequenced clinical isolates .

How can researchers distinguish between genetic variations in frdD that affect enzyme efficiency versus those that influence protein stability?

Distinguishing between FrdD variants affecting enzyme efficiency versus protein stability requires an integrated computational and experimental approach:

Computational approaches:

  • Stability predictions:

    • Use FoldX, Rosetta, or DUET to calculate ΔΔG of folding

    • Implement CUPSAT for prediction of stabilizing point mutations

    • Apply SDM for statistical potential energy function analysis

    • Values >2 kcal/mol suggest significant destabilization

  • Catalytic efficiency predictions:

    • Analyze proximity to catalytic sites or subunit interfaces

    • Assess conservation in functionally related but evolutionarily distant organisms

    • Evaluate changes in electrostatic properties near functional sites

    • Implement molecular dynamics simulations to assess dynamic effects

Experimental validation approaches:

TechniqueStability AssessmentEfficiency AssessmentKey Measurements
Thermal shift assaysMelting temperature (Tm)
Circular dichroismSecondary structure content
Limited proteolysisDigestion rate, protected fragments
Enzyme kineticsKm, kcat, kcat/Km
BN-PAGEComplex assembly efficiency
Isothermal titration calorimetryBinding affinity for substrates
Hydrogen-deuterium exchangeLocal stability and dynamics

A combined analysis will reveal whether a variant primarily affects:

  • Protein folding and stability

  • Complex assembly

  • Substrate binding

  • Catalytic efficiency

  • Regulatory interactions

This differentiation is crucial for understanding the mechanistic impact of variants identified in clinical isolates .

What statistical methods are most appropriate for correlating frdD genetic variations with V. cholerae virulence in epidemiological studies?

For robust correlation of frdD genetic variations with V. cholerae virulence in epidemiological studies, the following statistical approaches are recommended:

  • Genotype-phenotype association methods:

    • Logistic regression models with virulence as binary outcome

    • Multinomial regression for categorical virulence classifications

    • Calculation of odds ratios with 95% confidence intervals

    • Adjustment for potential confounders (geographic region, time period)

  • Population genetics approaches:

    • FST analysis to detect differentiation between high and low virulence strains

    • Tajima's D to detect selection signatures in frdD

    • Extended haplotype homozygosity tests for recent selection

    • Linkage disequilibrium analysis to identify co-evolving loci

  • Machine learning techniques:

    • Random forest classification of virulence phenotypes

    • Support vector machines for variant pattern recognition

    • Gradient boosting methods for predictive modeling

    • Feature importance ranking to identify key variants

  • Multivariate analyses:

    • Principal component analysis to identify variant clustering

    • Multiple correspondence analysis for categorical virulence data

    • Canonical correlation analysis for multiple virulence phenotypes

    • Partial least squares regression for handling multicollinearity

  • Bayesian approaches:

    • Bayesian network analysis to infer causal relationships

    • Hierarchical Bayesian models to account for population structure

    • Markov Chain Monte Carlo methods for parameter estimation

    • Bayesian Model Averaging to address model uncertainty

These approaches should incorporate:

  • Multiple test correction (e.g., Bonferroni, FDR)

  • Sensitivity analyses to assess robustness

  • Cross-validation to evaluate predictive performance

  • Power calculations to ensure adequate sample sizes

Recent studies of V. cholerae genomic diversity in African isolates demonstrate the utility of these approaches in identifying clinically relevant genetic determinants of virulence and antimicrobial resistance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.