Recombinant Vibrio cholerae serotype O1 Maltose transport system permease protein malG (malG)

Shipped with Ice Packs
In Stock

Description

General Context of Maltose Transport in Bacteria

Maltose transport in bacteria typically involves ATP-binding cassette (ABC) transporters, which consist of:

  • Substrate-binding proteins (SBPs): Recognize maltose in the periplasm.

  • Permease proteins: Facilitate membrane translocation (e.g., MalF and MalG in E. coli).

  • ATPase components: Hydrolyze ATP to drive substrate uptake.

Hypothetical Role of MalG in V. cholerae O1

Based on conserved ABC transporter mechanisms:

ComponentProposed Role in V. cholerae O1Supporting Evidence
MalG (Permease)Maltose translocation across membraneAnalogous to E. coli MalG (no direct data)
SBPMaltose recognitionNo data on V. cholerae homologs
ATPaseEnergy coupling for transportNo data on V. cholerae homologs

Note: Table represents inferred roles; no experimental validation exists.

Gaps in Current Research

The absence of MalG-specific studies in V. cholerae O1 highlights critical knowledge gaps:

  • Structural Insights: No crystallographic or cryo-EM data for MalG.

  • Functional Studies: No data on substrate specificity, transport kinetics, or regulatory interactions (e.g., with ToxT or c-di-GMP pathways).

  • Pathogenic Relevance: Potential links between maltose metabolism and virulence (e.g., biofilm formation, host colonization) remain unexplored.

Related Systems in V. cholerae O1

While MalG remains unstudied, other transport systems in V. cholerae O1 are well-characterized:

SystemFunctionKey Genes/ProteinsReferences
Galactose TransportGalactose catabolism; LPS synthesisgalU, galE
Polymyxin ResistanceLipid A glycylation; antimicrobial resistancealmEFG
Exopolysaccharide SynthesisBiofilm formation; environmental survivalvps, eps, msh

These systems underscore V. cholerae’s adaptability but do not address maltose transport.

Recommendations for Future Research

To advance understanding of MalG:

  1. Genomic Screening: Identify malG homologs in V. cholerae O1 genomes.

  2. Protein Expression: Recombinant production in heterologous systems (e.g., E. coli) for structural and functional studies.

  3. Functional Assays: Measure maltose uptake kinetics in V. cholerae ΔmalG mutants.

  4. Pathogenicity Link: Assess whether maltose metabolism impacts colonization or toxin production.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
malG; VC_A0943; Maltose/maltodextrin transport system permease protein MalG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-296
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Target Names
malG
Target Protein Sequence
MAMVQGKSLKYRVWATHAALWVFLALIIFPLLMIVAISFREGNFATGSLIPDRPSLEHWK LALGIAVQNADGSVTPPPFPVMTWLWNSVKVAGITSVLIVALSTTSAYAFARMRFKGKET ILKAMMIFQMFPAVLALVALYALFDKLGQYIPFLGLNTHGGLIFSYLGGIALHVWTIKGY FETIDRSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIGVVGEVPVASLLLSDV NSYTLAVGMQQYLYPQNYLWGDFAAAAVLSALPITIVFLLAQRWLVGGLTAGGVKG
Uniprot No.

Target Background

Function
This protein is part of the ABC transporter complex MalEFGK, which plays a crucial role in maltose/maltodextrin import. It is likely responsible for translocating the substrate across the membrane.
Database Links

KEGG: vch:VCA0943

STRING: 243277.VCA0943

Protein Families
Binding-protein-dependent transport system permease family, MalFG subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the maltose transport system permease protein malG in Vibrio cholerae O1?

The maltose transport system permease protein MalG is a component of the MalFGK₂ complex, which functions as an ATP-binding cassette (ABC) transporter in Vibrio cholerae serotype O1. This transport system facilitates the uptake of maltose and related sugars across the bacterial membrane. In V. cholerae, the maltose transport system contributes to bacterial metabolism and potentially to pathogenesis through its role in nutrient acquisition during infection. The system typically requires interaction with maltose binding protein (MBP) to function efficiently in wild-type bacteria .

How does the structure of MalG relate to its function in the maltose transport system?

MalG functions as part of the transmembrane component of the MalFGK₂ complex, where it forms a channel through which maltose can pass. Structurally, MalG contains multiple transmembrane helices that undergo conformational changes during the transport cycle. These conformational states include open, semi-open, and closed configurations of the transport complex. The specific residue L135 in MalG plays a critical role in its interaction with the MalF P4 loop, which influences the conformational dynamics of the transporter . These structural elements are crucial for the alternate access mechanism that allows maltose to be transported across the membrane while maintaining specificity.

What is the relationship between membrane proteins like malG and O1 antigen expression in Vibrio cholerae?

The relationship between membrane proteins and O1 antigen expression is complex and multifaceted. The O1 antigen, a component of the lipopolysaccharide in V. cholerae's outer membrane, is a major target for bacteriophages and the human immune system, making it critical for vaccine design . While malG itself is not directly involved in O1 antigen biosynthesis, membrane organization and transport systems can influence cellular processes that affect antigen expression. Research has identified two phase variable genes, manA and wbeL, that are required for O1 antigen biosynthesis, with manA encoding a phosphomannose isomerase critical for the initial step in O1 antigen biosynthesis . This phase variation mechanism allows V. cholerae to modulate O1 antigen expression, generating diverse subpopulations that can both infect the host intestinal tract and escape predation by O1-specific phages.

What are the conformational dynamics of binding-protein-independent mutants of malG?

This shifted equilibrium has functional consequences. The semi-open state allows MalG511 to interact with MBP with high affinity, which explains why higher concentrations of MBP (>50μM) can inhibit transport activity rather than enhance it . This provides a mechanistic explanation for the biphasic behavior observed in maltose transport assays with MalG511. The conformational dynamics data suggest that mutations in MalG can significantly alter the energy landscape of the transport cycle, creating variants with novel regulatory properties.

How does the MalG511 mutant differ from wild-type malG in terms of function and interaction with maltose binding protein?

The MalG511 mutant demonstrates several distinct functional characteristics compared to wild-type MalG:

  • Binding-protein independence: MalG511 exhibits high basal ATPase activity even in the absence of maltose binding protein (MBP), whereas wild-type MalG requires MBP for efficient activity .

  • Enhanced transport activity: MalG511 shows higher rates of maltose transport in intact cells (200 pmol/min/10⁹ cells) compared to wild-type MalFGK₂ (2 pmol/min/10⁹ cells) .

  • Biphasic response to MBP: At low concentrations, MBP stimulates MalG511 activity, while at higher concentrations (>25 μM), MBP inhibits transport activity .

  • Shifted conformational equilibrium: The MalG511 mutant exists predominantly in a semi-open state in its resting condition, which more closely resembles the transition state of wild-type MalFGK₂ .

The mutation in MalG511 (L135F) introduces a bulky phenylalanine residue that destabilizes the interaction between MalG and the MalF P4 loop, shifting the transporter toward a conformation that resembles the transition state of the wild-type complex . This altered conformational state has higher affinity for MBP, explaining the inhibitory effect of MBP at higher concentrations due to over-binding that may prevent completion of the transport cycle.

What mechanisms underlie the relationship between malG function and virulence in Vibrio cholerae?

The relationship between MalG function and V. cholerae virulence involves several interconnected mechanisms:

  • Nutrient acquisition during infection: Efficient maltose transport systems may provide metabolic advantages to V. cholerae in the host environment.

  • Cell surface composition: Transport systems like MalFGK₂ influence membrane organization, which can affect the presentation of virulence factors.

  • Stress responses: Alterations in nutrient transport can trigger bacterial stress responses that modulate virulence gene expression.

  • Host-pathogen interaction: Transport proteins may influence how V. cholerae interacts with host epithelial cells, affecting transcriptional responses in both the bacterium and host.

Research has shown that V. cholerae induces transcription of various host genes involved in innate mucosal immunity, intracellular signaling, and cellular proliferation . The transcriptional profiles induced by different V. cholerae strains correlate with their reactogenicity, with more reactogenic strains (including vaccine candidates with altered membrane components) inducing greater expression of proinflammatory cytokines . This suggests that membrane transport systems like MalG may indirectly influence virulence through their effects on bacterial-host interactions.

What are the optimal methods for studying conformational changes in malG and its mutants?

Studying conformational changes in MalG and its mutants requires sophisticated biophysical techniques. Based on current research, the following methodological approaches are recommended:

  • Site-Directed Spin Labeling (SDSL) with Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • This combined approach allows for the detection of conformational changes in specific regions of MalG during its catalytic cycle .

    • Methodology involves introducing cysteine residues at strategic positions in MalG for attachment of spin labels, followed by EPR spectroscopy to detect changes in spin label mobility that reflect protein conformational changes.

  • X-ray Crystallography:

    • Provides high-resolution structural information about different conformational states.

    • Requires successful crystallization of the MalFGK₂ complex in various states, which can be technically challenging.

  • Cryo-Electron Microscopy:

    • Allows visualization of the transporter in a near-native state without crystallization.

    • Can capture multiple conformational states simultaneously.

  • Förster Resonance Energy Transfer (FRET):

    • Enables real-time monitoring of conformational changes in solution.

    • Requires labeling of specific residues with fluorescent probes.

For optimal results, these methods should be applied to purified recombinant proteins reconstituted in membrane-mimetic environments such as nanodiscs or liposomes. Control experiments should include wild-type MalG for comparison and measurements under various conditions, including different nucleotide states (ATP, ADP, vanadate-trapped transition state) and in the presence or absence of maltose and MBP .

How can researchers effectively create and validate recombinant expressions of malG from Vibrio cholerae O1?

Creating and validating recombinant expressions of MalG from V. cholerae O1 involves several critical steps:

  • Gene Cloning and Expression System Selection:

    • The malG gene should be amplified from V. cholerae O1 genomic DNA using high-fidelity PCR.

    • For membrane proteins like MalG, expression systems that can handle membrane proteins are preferable, such as E. coli strains C41(DE3) or C43(DE3).

    • Expression vectors should include appropriate tags for purification and detection (His-tag, FLAG-tag).

  • Optimization of Expression Conditions:

    • Temperature, induction time, and inducer concentration should be systematically optimized.

    • For membrane proteins, lower expression temperatures (16-25°C) often yield better results.

    • Consider using specialized media formulations that enhance membrane protein expression.

  • Validation of Expression:

    • Western blotting using antibodies against the chosen tag or against MalG specifically.

    • Functional assays including ATPase activity measurements and transport assays using radioactively labeled or fluorescent maltose.

    • Conformational integrity assessment using circular dichroism spectroscopy or limited proteolysis.

  • Protein Purification and Reconstitution:

    • Solubilization with appropriate detergents (e.g., DDM, LMNG).

    • Affinity chromatography followed by size exclusion chromatography.

    • Reconstitution into proteoliposomes or nanodiscs for functional studies.

  • Validation of Functionality:

    • ATPase activity in the presence and absence of MBP and maltose.

    • Transport assays comparing wild-type and mutant variants.

    • Binding studies with MBP using surface plasmon resonance or isothermal titration calorimetry.

Control experiments should include parallel expression of well-characterized MalG proteins from other organisms and careful comparison with native V. cholerae MalG extracted from the organism.

How can contradictory findings in malG transport activity be reconciled?

Contradictory findings in MalG transport activity studies can arise from various sources and require systematic approaches to reconcile:

  • Experimental Design Variations:

    • Differences in sample size can lead to statistically unreliable results, particularly with small samples that have low statistical power .

    • Absence of proper control groups makes it impossible to isolate the effect of independent variables .

    • Confounding variables may influence outcomes if not properly controlled, making it difficult to determine if treatment had real effects .

  • Methodological Reconciliation Approaches:

    • Standardize protein preparation protocols to ensure consistent starting material.

    • Ensure adequate sample sizes to achieve statistical significance .

    • Implement rigorous control groups to isolate effects of specific variables .

    • Account for confounding variables through experimental design or statistical methods .

    • Validate findings using multiple complementary techniques.

  • Systematic Analysis of Biphasic Behaviors:

    • The biphasic behavior observed with MalG511, where low MBP concentrations stimulate activity while higher concentrations inhibit it , illustrates how complex transport mechanisms can lead to apparently contradictory results.

    • Complete dose-response curves should be generated rather than single-point measurements.

    • Kinetic analyses should examine the full transport cycle rather than isolated steps.

  • Contextual Factors:

    • MalG's function may differ based on environmental conditions, lipid composition, or the presence of other cellular components.

    • The genetic background of the bacterial strain used can affect experimental outcomes.

    • Phase variation in genes affecting membrane composition can generate heterogeneity within seemingly identical bacterial populations .

When analyzing contradictory data, researchers should examine whether differences might reflect biological reality rather than experimental error, as with the case of MalG511 which exhibits genuine biphasic responses to MBP concentration .

What challenges exist in correlating malG function with O1 antigen expression and vaccine development?

Correlating MalG function with O1 antigen expression and vaccine development presents several significant challenges:

  • Heterogeneity in O1 Antigen Expression:

    • Phase variation in genes required for O1 antigen biosynthesis (manA and wbeL) creates heterogeneous bacterial populations .

    • This heterogeneity makes it difficult to establish direct correlations between MalG function and O1 antigen expression.

    • Research has shown that phase variants of these genes are attenuated for virulence, supporting the critical role of O1 antigen for infectivity .

  • Vaccine Design Implications:

    • Current licensed cholera vaccines contain limited variants of killed whole cells of the O1 V. cholerae serogroup, while newer variants continue to emerge, including non-O1 types that cause disease in some areas .

    • The presence of distinct genetic virulence markers influences clinical cholera manifestations .

    • Inter-serotype polymorphism in virulence markers may affect vaccine efficacy in specific geographical areas .

  • Methodological Approaches:

    • Multi-locus variable number of tandem repeats analysis (MLVA) has emerged as a valuable tool for tracking disease spread through strain differentiation .

    • Molecular epidemiological studies are essential to detect virulence markers and antimicrobial resistance patterns .

    • Comprehensive analysis should include serotyping, detection of virulence genes (ctxB, zot, tcpA, etc.), and antimicrobial susceptibility testing .

  • Emerging Resistance Concerns:

    • The emergence of antimicrobial drug resistance necessitates routine monitoring of strain susceptibility .

    • Multidrug resistance has been observed in recent V. cholerae isolates, complicating treatment approaches .

These challenges highlight the importance of integrating studies of membrane transport systems with broader investigations of bacterial virulence, antigen expression, and vaccine efficacy.

What promising approaches exist for targeting malG in cholera vaccine development?

Several promising approaches for targeting MalG in cholera vaccine development warrant further investigation:

  • Structure-Based Antigen Design:

    • Using the structural insights from MalG and its conformational dynamics to design stable antigens that elicit immune responses against conserved epitopes.

    • These could potentially target conformational states of MalG that are essential for bacterial survival or virulence.

  • Attenuated Live Vaccine Strains:

    • Engineered MalG mutants could potentially serve as the basis for attenuated live vaccine strains.

    • Previous recombinant live oral cholera vaccines that deleted genes encoding cholera toxin (CT) were still reactogenic in human volunteers .

    • Understanding how membrane proteins like MalG influence host responses could lead to better attenuation strategies that maintain immunogenicity while reducing reactogenicity.

  • Broader O1 Serotype Coverage:

    • Current licensed cholera vaccines contain limited variants of killed whole cells of the O1 V. cholerae serogroup .

    • Integrating knowledge about phase variation in O1 antigen expression with membrane transport system biology could lead to vaccines with broader protection against emerging variants.

    • Including both Ogawa and Inaba serotypes is important, as studies have identified 89.9% of clinical isolates as Ogawa and 1.8% as Inaba in some outbreaks .

  • Multi-Target Vaccine Approaches:

    • Combining MalG-based antigens with other targets to address the multiple virulence factors of V. cholerae.

    • Research has identified numerous virulence genes in clinical isolates, including ctxB, zot, tcpA, ace, rtxC, toxR, rtxA, tcpP, hlyA, and tagA .

    • A comprehensive vaccine approach might target multiple components to overcome the phase variation escape mechanism employed by the pathogen .

  • Host-Response Modulation:

    • Studies of transcriptional responses in intestinal epithelial cells to V. cholerae infection reveal that different strains induce varying levels of host genes involved in innate immunity, signaling, and cell proliferation .

    • Vaccine designs could incorporate elements that specifically modulate these host responses to promote protective immunity while minimizing inflammatory reactions.

How might advanced understanding of malG conformational dynamics improve experimental design?

Advanced understanding of MalG conformational dynamics can significantly improve experimental design in several ways:

  • Rational Mutation Design:

    • Knowledge that MalG511's L135F mutation shifts equilibrium toward the semi-open state provides a template for designing other mutations with predictable effects.

    • Researchers can target specific residues at interfaces between subunits or domains to modulate conformational equilibria.

    • These rationally designed mutants can serve as tools to investigate specific aspects of transport mechanisms.

  • State-Specific Inhibitor Development:

    • Understanding the different conformational states of MalG enables the design of state-specific inhibitors.

    • Compounds that stabilize particular conformations can be developed as research tools to "lock" the transporter in specific states.

    • These tools would allow dissection of individual steps in the transport cycle.

  • Improved Biophysical Measurements:

    • Knowledge of key residues involved in conformational changes guides the placement of spectroscopic probes.

    • For SDSL-EPR studies, this allows strategic placement of spin labels at positions most likely to show significant changes between states .

    • For fluorescence-based studies, knowledge of domain movements helps optimize FRET pair placements.

  • Better Control Experiments:

    • Understanding that factors like the presence of MBP can have concentration-dependent biphasic effects on transport activity helps design more comprehensive control experiments.

    • Rather than testing single concentrations, researchers should implement concentration gradients.

    • Controls should account for the possibility of bimodal responses rather than assuming linear relationships.

  • Integration of Multiple Techniques:

    • Knowledge of conformational dynamics encourages experimental designs that combine complementary techniques.

    • For example, integrating structural studies (X-ray, cryo-EM) with dynamic measurements (EPR, FRET) and functional assays (transport, ATPase) provides a more complete picture.

    • This multi-technique approach can help avoid pitfalls in experiment design by providing independent verification of results.

What are the key unanswered questions about malG in Vibrio cholerae O1 that could advance vaccine development?

Several key unanswered questions about MalG in Vibrio cholerae O1 remain critical for advancing vaccine development:

  • Antigenic Properties and Immune Recognition:

    • How does the host immune system recognize different conformational states of MalG?

    • Are there conserved epitopes in MalG that could serve as targets for broadly protective antibodies?

    • How does phase variation in O1 antigen biosynthesis genes affect the presentation and recognition of membrane proteins like MalG?

  • Role in Host-Pathogen Interactions:

    • Does MalG directly or indirectly contribute to the reactogenicity observed in attenuated V. cholerae vaccine strains ?

    • How does MalG function influence the transcriptional responses of human intestinal epithelial cells during infection?

    • Could modifications to MalG reduce inflammatory responses while maintaining immunogenicity?

  • Population Heterogeneity and Vaccine Coverage:

    • How does the genetic diversity of malG across global V. cholerae isolates impact potential vaccine coverage?

    • Do geographical differences in malG sequences correlate with vaccine efficacy variations?

    • Can vaccines be designed to address the emergence of new variants with altered membrane protein profiles ?

  • Integration with O1 Antigen Biology:

    • What is the spatial relationship between MalG and the O1 antigen on the bacterial surface?

    • How do phase variations in O1 antigen biosynthesis genes (manA and wbeL) affect MalG function and vice versa?

    • Could targeting both MalG and O1 antigen biosynthesis components create synergistic vaccine strategies?

  • Persistence and Adaptation Mechanisms:

    • How does MalG contribute to V. cholerae survival in different environments?

    • Does malG expression or function change during different stages of infection?

    • How do modifications in malG contribute to the emergence of antimicrobial resistance ?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.