Recombinant Vibrio cholerae serotype O1 Na (+)-translocating NADH-quinone reductase subunit C

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nqrC; VC0395_A1882; VC395_2409; Na(+-translocating NADH-quinone reductase subunit C; Na(+-NQR subunit C; Na(+-translocating NQR subunit C; NQR complex subunit C; NQR-1 subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-257
Protein Length
Full Length of Mature Protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Target Names
nqrC
Target Protein Sequence
ASNNDSIKKTLFVVIALSLVCSIIVSAAAVGLRDKQKENAALDKQSKILQVAGIEAKGSK QIVELFNKSIEPRLVDFNTGDFVEGDAANYDQRKAAKEASESIKLTAEQDKAKIQRRANV GVVYLVKDGDKTSKVILPVHGNGLWSMMYAFVAVETDGNTVSGLTYYEQGETPGLGGEVE NPAWRAQWVGKKLFDENHKPAIKIVKGGAPQGSEHGVDGLSGATLTSNGVQNTFDFWLGD MGFGPFLTKVRDGGLN
Uniprot No.

Target Background

Function

The NQR complex catalyzes the two-step reduction of ubiquinone-1 to ubiquinol, coupled with Na+ ion transport from the cytoplasm to the periplasm. NqrA through NqrE are likely involved in the second step, converting ubisemiquinone to ubiquinol.

Database Links
Protein Families
NqrC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

What is the functional role of Na⁺-NQR Subunit C in Vibrio cholerae metabolism?

Na⁺-NQR Subunit C (NqrC) is part of the respiratory enzyme complex responsible for electron transfer from NADH to quinone, coupled with Na⁺ translocation across the membrane. This activity generates a sodium motive force (SMF) critical for ATP synthesis, flagellar rotation, and ion homeostasis . Key methodologies to study this include:

  • Gene deletion strains: ΔnqrA-F mutants show metabolic defects, including altered TCA cycle activity and purine metabolism .

  • Metabolomic profiling: Mass spectrometry revealed decreased isocitrate and increased malate/succinate levels in Δnqr mutants, suggesting a shift toward reductive TCA cycle pathways .

How is recombinant Na⁺-NQR Subunit C purified for structural studies?

A standardized protocol involves:

  • Cloning: The nqr operon is expressed in a Δnqr V. cholerae strain under a P<sub>BAD</sub> promoter .

  • Affinity chromatography: A hexahistidine tag on the C-terminal of NqrF enables purification using detergent-solubilized membranes .

  • Activity assays: Purified enzyme exhibits a turnover number of 720 electrons/sec and Na⁺-dependent stimulation .

Advanced Research Questions

How does Na⁺-NQR deletion lead to contradictory phenotypes in ion transport and virulence?

While Na⁺-NQR is the primary Na⁺ pump, Δnqr strains retain Na⁺-pumping capacity due to compensatory mechanisms . Key findings include:

  • Redundant Na⁺ pumps: Secondary transporters maintain ion gradients, masking Na⁺-NQR’s role in Δnqr strains under standard conditions .

  • Virulence modulation: Δnqr strains show reduced persistence in murine models but upregulated virulence factors (e.g., TcpA, AcfC) during glucose metabolism .

What experimental approaches resolve contradictions in Na⁺-NQR’s role in reactive oxygen species (ROS) production?

Na⁺-NQR’s flavin cofactors (e.g., in NqrF) generate superoxide radicals, detectable via:

  • DCFH-DA assays: Quantify cytoplasmic ROS in wild-type vs. Δnqr strains .

  • Membrane fraction analysis: Wild-type membranes produce 9.8 μmol superoxide/min/mg protein vs. 0.18 μmol in Δnqr .

How does Na⁺-NQR influence V. cholerae’s transition to intestinal habitats?

Na⁺-NQR-derived ROS may act as signaling molecules during host adaptation:

  • Transcriptomic data: Δnqr strains downregulate sialic acid catabolism genes, impairing nutrient scavenging in mucus-rich environments .

  • Proteomic profiling: Elevated CadAB activity in Δnqr mutants increases cadaverine production, potentially altering pH stress responses .

Methodological Insights

Table 1: Metabolic Changes in Δnqr V. cholerae (Adapted from )

MetaboliteChange (Δnqr vs. WT)Proposed Pathway Impact
Isocitrate↓ 2.5-foldOxidative TCA cycle impairment
Malate↑ 3.1-foldReductive TCA cycle activation
Cadaverine↑ 4.8-foldLysine decarboxylase (CadA) upregulation

Table 2: Proteomic Signatures in Δnqr Strains (Adapted from )

ProteinFunctionAbundance Change (Δnqr)
FlgH (VC2194)Flagellar L-ring↓ 3.5-fold
TcpA (VC0828)Toxin co-regulated pilus↑ 4.1-fold
AcfC (VC0841)Accessory colonization factor↑ 2.6-fold

Key Methodologies for Contradiction Analysis

  • Phenotype Microarray (Biolog): Identifies substrate utilization defects in Δnqr mutants .

  • Redox titration: Resolves flavin/Fe-S center contributions to electron transfer .

  • Liposome reconstitution: Measures Na⁺ gradient and ΔΨ generation by purified Na⁺-NQR .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.