Recombinant Vibrio cholerae serotype O1 Na (+)-translocating NADH-quinone reductase subunit E

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please contact your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is dependent on various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
nqrE; VC0395_A1880; VC395_2407; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Target Names
nqrE
Target Protein Sequence
MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGIAVIVVLTISVPVNNLVY NLVLKPDALVEGVDLSFLNFITFIGVIAALVQILEMILDRFFPPLYNALGIFLPLITVNC AIFGGVSFMVQRDYSFAESVVYGFGSGVGWMLAIVALAGIREKMKYSDVPPGLRGLGITF ITAGLMALGFMSFSGVQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two sequential reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Na(+)-NQR in Vibrio cholerae?

Na(+)-translocating NADH:quinone oxidoreductase (Na+-NQR) in Vibrio cholerae is a membrane-associated respiratory complex consisting of six subunits (NqrA-F). This enzyme catalyzes the oxidation of NADH and the reduction of quinones in the respiratory chain while simultaneously pumping sodium ions across the membrane. The complex contains multiple redox-active centers including covalently bound flavins in the NqrB and NqrC subunits, and a 2Fe-2S cluster. Redox titration studies reveal three n = 2 redox centers and one n = 1 redox center, which can be attributed to three flavins and a 2Fe-2S center .

Na+-NQR functions as a primary sodium pump, exhibiting up to 5-fold stimulation by sodium ions and generating both a sodium gradient and an electrical potential (ΔΨ) across the membrane when reconstituted into liposomes . The enzyme plays a crucial role in V. cholerae's adaptation to high salt environments, as it establishes a sodium motive force that drives numerous cellular processes. Additionally, during NADH oxidation by Na+-NQR, ubisemiquinones are formed which can react with molecular oxygen to produce superoxide and other reactive oxygen species .

How does Na(+)-NQR contribute to V. cholerae pathogenicity?

Na+-NQR significantly influences V. cholerae pathogenicity through multiple mechanisms. Primarily, it allows V. cholerae to adapt to the high sodium environments encountered during infection by actively extruding sodium ions from the cytoplasm, establishing a sodium motive force across the inner membrane . This adaptation is crucial for the bacterium's survival and growth in the human intestinal environment where sodium concentrations are elevated.

Experimental evidence demonstrates that Na+-NQR contributes to the production of reactive oxygen species (ROS), which may influence host-pathogen interactions. Wild-type V. cholerae cells produce extracellular superoxide at a specific activity of 10.2 nmol min⁻¹mg⁻¹, while a mutant strain lacking Na+-NQR produces only 3.1 nmol min⁻¹mg⁻¹ . Similarly, H₂O₂ formation is threefold higher in wild-type cells compared to the Na+-NQR deletion strain . The ability to modulate ROS production in response to environmental sodium levels may provide V. cholerae with advantages during infection by affecting host defense mechanisms or signaling pathways.

Research using in vivo infection models has identified genes induced during infection, including those involved in metabolism and bioenergetics, which may include components of respiratory complexes like Na+-NQR . These findings suggest that Na+-NQR activity is regulated during the infectious process, highlighting its relevance to pathogenicity.

How does sodium concentration affect Na(+)-NQR activity?

Sodium concentration significantly influences Na+-NQR activity through multiple mechanisms. Experimental evidence shows that increasing Na+ concentration from 0.08 mM to 14.7 mM results in a 2-fold increase in the concentration of ubisemiquinone radicals (from 0.2 mM to 0.4 mM) in V. cholerae membranes . This indicates that sodium directly affects the redox state of the quinone pool in the bacterial membrane.

In intact V. cholerae cells, raising the Na+ concentration from 0.1 to 5 mM increases the rate of superoxide formation by at least 70% in wild-type strains . This sodium-dependent enhancement of superoxide production is not observed in mutant strains lacking the Na+-NQR, confirming the enzyme's role in this process. The recombinant Na+-NQR enzyme exhibits up to 5-fold stimulation by sodium in steady-state turnover assays .

Mechanistically, sodium ions likely influence the enzyme's activity by affecting the rates of specific electron transfer steps within the complex. The binding of sodium to the enzyme may induce conformational changes that alter the redox potentials of the cofactors or the kinetics of electron transfer between them. This sodium dependency reflects the enzyme's physiological role as a primary sodium pump, coupling the energy released during NADH oxidation to the uphill transport of sodium ions across the membrane.

What expression systems are effective for producing recombinant Na(+)-NQR subunit E?

Effective expression of recombinant Na+-NQR subunit E (NqrE) requires careful consideration of host systems and expression conditions. Based on available research, homologous expression in V. cholerae itself has proven successful for producing the complete Na+-NQR complex . The approach involves cloning the entire nqr operon under the regulation of a controllable promoter such as the P(BAD) promoter, which allows for inducible expression.

For optimal expression, researchers have constructed a host strain of V. cholerae in which the genomic copy of the nqr operon is deleted . This strategy prevents interference from the native enzyme and ensures that only the recombinant complex is produced. The expression vector can be designed with affinity tags, such as a six-histidine tag on one of the subunits (commonly the C-terminus of NqrF), to facilitate purification .

When designing expression systems for NqrE specifically, researchers should consider its membrane-associated nature and potential toxicity. Experience with other V. cholerae proteins indicates that high constitutive expression can be problematic; plasmids predicted to give very high constitutive levels of cholera toxin B subunit (CTB) were unstable in E. coli . Similar issues might arise with NqrE, necessitating careful regulation of expression levels.

Methodology for successful expression includes optimization of induction conditions, growth media composition (particularly sodium concentration), and temperature. The final yield and activity of the recombinant protein should be assessed through activity assays and Western blotting with subunit-specific antibodies.

What are the challenges in expressing full Na(+)-NQR complex versus individual subunits?

Expressing the full Na+-NQR complex presents distinct challenges compared to expressing individual subunits like NqrE. The complete complex requires coordinated expression of all six subunits in the correct stoichiometry, proper membrane insertion, and correct incorporation of multiple cofactors including flavins and iron-sulfur clusters. Research has shown that successful expression of the entire complex can be achieved using the native nqr operon under the control of an inducible promoter in V. cholerae .

When expressing individual subunits, several challenges arise. First, subunits may not fold correctly in isolation, as their native structure may depend on interactions with other complex components. Second, membrane proteins like NqrE may be toxic when overexpressed, causing growth inhibition or plasmid instability. This has been observed with other V. cholerae proteins, where plasmids designed for high-level expression were unstable in E. coli and could only be maintained in V. cholerae .

Another significant challenge is the incorporation of cofactors. Two Na+-NQR subunits (NqrB and NqrC) contain covalently bound flavin , requiring specific enzymatic machinery for proper attachment. Expression systems must provide the necessary enzymes and precursors for these post-translational modifications.

Methodologically, researchers should consider using fusion partners to improve solubility and stability of individual subunits, and carefully optimize expression conditions to balance protein yield with host cell viability. Complementary approaches such as in vitro reconstitution of separately expressed subunits may also be valuable for studying the complex assembly process.

How can the stability of recombinant Na(+)-NQR be optimized?

Optimizing the stability of recombinant Na+-NQR requires attention to multiple factors throughout the expression, purification, and storage processes. During expression, maintaining appropriate sodium concentrations in the growth medium is critical, as sodium ions directly affect the enzyme's activity and potentially its stability . Temperature control during expression can also impact proper folding and assembly of the complex.

The choice of detergent for solubilization and purification significantly influences enzyme stability and activity. Research has shown that different detergents affect the quinone content and oxygen reactivity of the purified enzyme; when purified using dodecyl maltoside (DM), the isolated enzyme contains approximately one bound ubiquinone, whereas using LDAO results in negligible quinone content . The enzyme purified with DM has a relatively low rate of reaction with O₂ (10-20 s⁻¹), which may contribute to its stability by reducing oxidative damage .

For long-term stability, the addition of specific lipids during or after purification may help maintain the enzyme's native environment. Since Na+-NQR is a membrane protein complex, its stability often depends on maintaining lipid-protein interactions. Additionally, storing the enzyme with its substrates or substrate analogs at appropriate concentrations can stabilize specific conformations.

What purification strategies yield the highest activity for recombinant Na(+)-NQR?

Effective purification of recombinant Na+-NQR with high activity requires a carefully designed strategy that preserves the complex's structural integrity and cofactor content. Affinity chromatography using a six-histidine tag on the C-terminus of the NqrF subunit has proven successful for purifying the entire complex in a highly active form from detergent-solubilized membranes of V. cholerae . This approach enables single-step purification while maintaining the association of all six subunits.

The choice of detergent is crucial for preserving activity. Research demonstrates that dodecyl maltoside (DM) is superior to LDAO for maintaining quinone content in the purified enzyme, which is essential for its electron transfer function . The purification protocol should include appropriate concentrations of sodium ions throughout, as sodium significantly stimulates the enzyme's activity .

For optimal results, a methodical approach should include:

  • Careful cell lysis under conditions that prevent proteolysis (protease inhibitors) and oxidative damage (reducing agents)

  • Membrane isolation by differential centrifugation

  • Controlled solubilization with selected detergents at optimal ratios to membrane protein

  • Affinity chromatography with imidazole gradient elution

  • Optional size exclusion chromatography to separate fully assembled complex from subcomplexes

Activity assays should be performed at each purification step to track recovery and specific activity. The purified enzyme can achieve NADH consumption with a turnover number of 720 electrons per second, providing a benchmark for assessing purification success . The final preparation should be characterized by SDS-PAGE to confirm the presence of all six subunits and by spectroscopic methods to verify cofactor content.

How can researchers measure Na(+)-NQR activity in recombinant systems?

Measuring Na+-NQR activity in recombinant systems requires careful selection of assays that can detect different aspects of the enzyme's function. The primary activity of Na+-NQR involves NADH oxidation coupled to quinone reduction and sodium ion translocation. Several complementary methodologies provide comprehensive assessment of these functions.

NADH oxidation activity can be measured spectrophotometrically by monitoring the decrease in absorbance at 340 nm (ε = 6.22 mM⁻¹cm⁻¹). For recombinant Na+-NQR, this activity occurs at a high turnover number of approximately 720 electrons per second . Inhibition by specific Na+-NQR inhibitors such as 2-n-heptyl-4-hydroxyquinoline N-oxide (HQNO) or silver ions (Ag+) can confirm the specificity of the observed activity . Silver ions inhibit at least 86% of the NADH dehydrogenase activity in wild-type V. cholerae membranes .

Quinone reduction can be assessed using artificial electron acceptors like ubiquinone-1 (Q₁) or decylubiquinone. The dependence of activity on sodium concentration should be determined by varying Na+ levels from 0.1 to at least 15 mM, as the enzyme exhibits up to 5-fold stimulation by sodium . The [radical]/[Na+-NQR] ratio can reach 340:1 at 14.7 mM Na+, indicating extensive formation of ubisemiquinone radicals during catalysis .

For studying sodium translocation, reconstitution of purified recombinant Na+-NQR into liposomes allows measurement of the sodium gradient and membrane potential (ΔΨ) generated during enzyme activity . Sodium movement can be monitored using sodium-sensitive fluorescent dyes or ²²Na+ radioisotope techniques. The membrane potential can be assessed with potential-sensitive dyes such as oxonol VI.

What techniques are used to study electron transfer within the Na(+)-NQR complex?

Studying electron transfer within the Na+-NQR complex requires sophisticated spectroscopic and electrochemical techniques to capture the movement of electrons between various redox centers. Electron paramagnetic resonance (EPR) spectroscopy is particularly valuable for detecting organic radicals formed during enzyme activity. In native V. cholerae membranes, EPR has successfully identified ubisemiquinone radicals generated by Na+-NQR upon reduction with NADH . The radical concentration increases with sodium concentration, providing insights into how the coupling cation influences electron transfer dynamics.

Redox titrations monitored by UV-visible spectroscopy can reveal the midpoint potentials of different redox centers within the complex. Such analyses have identified three n = 2 redox centers and one n = 1 redox center in V. cholerae Na+-NQR, corresponding to three flavins and a 2Fe-2S center . This information helps establish the thermodynamic feasibility of electron transfer pathways within the complex.

Stopped-flow spectroscopy enables researchers to follow the kinetics of electron transfer reactions on millisecond to second timescales. By rapidly mixing the enzyme with substrates and monitoring spectral changes associated with reduction/oxidation of specific cofactors, the sequence and rates of electron transfer events can be determined.

For investigating the relationship between electron transfer and superoxide formation, assays using superoxide-specific detection systems such as cytochrome c reduction (inhibitable by superoxide dismutase) are effective. Wild-type V. cholerae produces extracellular superoxide at a rate of 10.2 nmol min⁻¹mg⁻¹, compared to 3.1 nmol min⁻¹mg⁻¹ in an NQR deletion strain . Inhibitor studies with HQNO have shown that blocking quinone-binding sites reduces both radical formation and superoxide production, confirming their mechanistic link .

How can researchers investigate the Na+ translocation mechanism of recombinant Na(+)-NQR?

Investigating the Na+ translocation mechanism of recombinant Na+-NQR requires a multifaceted approach combining biochemical, biophysical, and genetic techniques. Liposome reconstitution experiments serve as a foundation for these studies by demonstrating that purified recombinant Na+-NQR can generate both a sodium gradient and an electrical potential (ΔΨ) across the membrane . This confirms the enzyme's primary sodium pumping function and provides a system for detailed mechanistic investigations.

Site-directed mutagenesis of conserved charged residues in the membrane subunits, particularly NqrB, NqrD, and NqrE, can identify amino acids essential for sodium binding and translocation. Mutants should be characterized for their ability to oxidize NADH, reduce quinones, and transport sodium ions to distinguish defects in electron transfer from defects in ion translocation.

Sodium ion binding studies using techniques such as ²²Na+ binding assays or isothermal titration calorimetry can determine binding affinities, stoichiometry, and the influence of the enzyme's redox state on sodium binding. These experiments should be conducted with both the wild-type enzyme and strategic mutants to establish structure-function relationships.

To connect electron transfer events with sodium translocation, researchers can employ simultaneous measurement of NADH oxidation (absorbance at 340 nm), quinone reduction, and sodium movement. The kinetic relationships between these processes can reveal whether sodium translocation occurs during specific electron transfer steps and whether it follows a redox-coupled or conformationally-coupled mechanism.

The sodium dependence of different partial reactions within the catalytic cycle should be investigated by varying sodium concentration and measuring the effects on reaction rates. The data showing that radical concentration increases from 0.2 mM at 0.08 mM Na+ to 0.4 mM at 14.7 mM Na+ suggests that sodium levels influence the equilibrium between different enzyme states.

What are effective methods for studying subunit-subunit interactions in recombinant Na(+)-NQR?

Studying subunit-subunit interactions in recombinant Na+-NQR requires techniques that can capture both stable associations and transient interactions that may occur during the catalytic cycle. Cross-linking approaches using chemical cross-linkers with various spacer lengths can identify subunits that are in close proximity. After cross-linking, the products can be analyzed by SDS-PAGE and mass spectrometry to identify specific interaction sites. This approach is particularly valuable for mapping the interfaces between NqrE and other subunits.

Co-immunoprecipitation experiments using antibodies against individual subunits can pull down interaction partners and confirm associations within the complex. For recombinant Na+-NQR with a six-histidine tag on the NqrF subunit , pull-down assays with anti-His antibodies can verify which subunits remain associated under various conditions, such as different detergents or salt concentrations.

Förster resonance energy transfer (FRET) techniques, where donor and acceptor fluorophores are attached to different subunits, can provide information about distances between specific sites and detect conformational changes that alter subunit relationships during catalysis. This approach requires strategic placement of fluorophores at positions that don't disrupt function.

Genetic approaches such as suppressor mutation analysis can identify functionally important interactions. Primary mutations that disrupt activity might be compensated by secondary mutations in interacting subunits, revealing pairs of residues involved in subunit communication.

Computational methods including molecular modeling and molecular dynamics simulations can integrate experimental data to predict subunit arrangements and identify potential interaction surfaces. These predictions can guide experimental design for validating specific interactions.

The observation that all six subunits of Na+-NQR are resolved by SDS-PAGE after purification indicates that the complex remains intact during isolation, suggesting strong interactions between subunits. Understanding these interactions is crucial for elucidating how electron transfer is coupled to sodium transport across multiple protein subunits.

How does V. cholerae Na(+)-NQR compare to Na(+)-NQR from other bacterial species?

The Na+-NQR from Vibrio cholerae shares fundamental structural and functional similarities with Na+-NQR enzymes from other bacterial species while exhibiting some distinctive characteristics. Comparatively, V. cholerae Na+-NQR functions as a primary sodium pump with up to 5-fold stimulation by sodium, similar to Na+-NQR from other bacterial sources . This consistent sodium dependence reflects the conserved role of these enzymes in bacterial bioenergetics.

The V. cholerae enzyme contains the same complement of six subunits (NqrA-F) as found in other species, with similar cofactor composition including covalently bound flavins in NqrB and NqrC subunits and a 2Fe-2S center . The enzyme purified from V. cholerae shows a high specific activity with NADH consumption at a turnover number of 720 electrons per second , demonstrating efficient catalytic capability comparable to other bacterial Na+-NQR enzymes.

Regarding differences, the recombinant V. cholerae Na+-NQR purified with dodecyl maltoside contains approximately one bound ubiquinone, whereas the purification with LDAO results in negligible quinone content . This sensitivity to purification conditions might vary between species and affects the enzyme's properties, particularly its reaction with oxygen. The V. cholerae enzyme purified with DM exhibits a relatively low rate of reaction with O₂ (10-20 s⁻¹) , which might reflect adaptation to specific environmental niches.

The contribution of Na+-NQR to superoxide formation appears significant in V. cholerae, with wild-type cells producing extracellular superoxide at a rate three times higher than a mutant strain lacking Na+-NQR . This relationship between Na+-NQR activity and reactive oxygen species production may vary among species depending on their ecological contexts and stress response mechanisms.

What is known about the evolutionary conservation of Na(+)-NQR subunit E?

The evolutionary conservation of Na+-NQR subunit E (NqrE) reflects its essential role in the structure and function of the enzyme complex across different bacterial species. While the provided search results don't specifically address the conservation of NqrE, general principles of Na+-NQR evolution can be inferred from the available information on the entire complex.

Na+-NQR represents a unique respiratory enzyme found primarily in marine and pathogenic bacteria that must cope with high sodium environments. The presence of the complete six-subunit Na+-NQR complex in V. cholerae, including NqrE, indicates its importance for survival in its ecological niche. The enzyme's role in establishing a sodium motive force for energy conservation represents a specialized adaptation to sodium-rich environments .

Methodologically, researchers can assess NqrE conservation through comparative genomics approaches. Sequence alignment of nqrE genes from diverse bacterial species can identify highly conserved residues that likely play critical structural or functional roles. Conservation analysis should focus particularly on membrane-spanning segments and regions predicted to be involved in sodium binding or inter-subunit interactions.

Phylogenetic analysis of nqrE sequences can reveal patterns of co-evolution with other subunits of the complex and correlate with the organisms' adaptation to specific environments. The organization of the nqr operon, with all six subunit genes typically arranged in a single transcriptional unit , suggests strong selective pressure to maintain the complete complex throughout evolution.

Structure-function relationships in NqrE can be explored by comparing conserved features with the enzyme's known activities, such as sodium pumping and quinone reduction. Conserved charged residues in transmembrane domains may participate in sodium binding and translocation, while regions that interact with other subunits would show co-evolution patterns with their interaction partners.

How do mutations in the nqrE gene affect Na(+)-NQR function and V. cholerae virulence?

Mutations in the nqrE gene can profoundly impact Na+-NQR function and consequently affect V. cholerae virulence through multiple mechanisms. Although the search results don't provide direct information about nqrE mutations specifically, the effects can be inferred from studies of the Na+-NQR complex as a whole. Complete deletion of the Na+-NQR complex significantly reduces the production of reactive oxygen species, with superoxide formation decreasing from 10.2 to 3.1 nmol min⁻¹mg⁻¹ and H₂O₂ formation decreasing from 30.9 to 9.7 nmol min⁻¹mg⁻¹ . Mutations in nqrE would likely cause similar defects if they disrupt the assembly or function of the complex.

Since Na+-NQR is the primary sodium pump in V. cholerae, mutations affecting NqrE could impair sodium extrusion, compromising the bacterium's ability to maintain appropriate intracellular sodium levels in the high-sodium environment of the human intestine. This would impact numerous sodium-dependent cellular processes and potentially reduce survival during infection.

Methodologically, researchers can create specific nqrE mutations using site-directed mutagenesis and evaluate their effects on:

  • Complex assembly - by analyzing subunit composition of purified Na+-NQR

  • NADH oxidation activity - by spectrophotometric assays

  • Quinone reduction and radical formation - by EPR spectroscopy

  • Sodium pumping - by measuring sodium gradients in liposomes

  • Superoxide and H₂O₂ production - by specific detection assays

  • Virulence - using infection models such as the infant mouse model

The link between Na+-NQR function and virulence can be further explored by looking at gene expression during infection. Studies have identified V. cholerae genes that are transcriptionally induced during infection in an infant mouse model, including genes involved in metabolism, biosynthesis, and motility . Changes in the expression or function of the Na+-NQR complex during infection would suggest its importance in the pathogenic process.

How can recombinant Na(+)-NQR be used in drug development research?

Recombinant Na+-NQR offers several valuable applications in drug development research targeting Vibrio cholerae infections. As a primary sodium pump essential for V. cholerae's adaptation to high-sodium environments, Na+-NQR represents an attractive target for developing novel antimicrobial agents. The successful expression and purification of recombinant Na+-NQR with high specific activity provides a reliable platform for high-throughput screening of potential inhibitors.

Drug development efforts can focus on several aspects of Na+-NQR function. The enzyme's quinone binding sites represent promising targets, as demonstrated by the inhibitory effect of 2-n-heptyl-4-hydroxyquinoline N-oxide (HQNO) on both radical formation and superoxide production . Structure-based drug design approaches can utilize information about the enzyme's redox centers and sodium binding sites to design compounds that interfere with electron transfer or sodium translocation.

Methodologically, researchers can implement activity assays measuring NADH oxidation, quinone reduction, or sodium pumping to screen compound libraries for inhibitory effects. The established connection between Na+-NQR activity and reactive oxygen species production offers additional screening approaches based on superoxide or H₂O₂ detection. Compounds that specifically inhibit Na+-NQR without affecting human enzymes would be candidates for further development.

Recombinant Na+-NQR can also be used to generate antibodies or aptamers for diagnostic applications. The ability to produce the enzyme with a six-histidine tag facilitates purification for immunization or selection procedures. Additionally, the recombinant enzyme serves as a positive control for evaluating the specificity and efficacy of developed inhibitors against the native enzyme in V. cholerae cells.

The sodium dependence of Na+-NQR activity suggests that modulating environmental sodium levels could be explored as an adjunct therapeutic approach, potentially enhancing the efficacy of Na+-NQR inhibitors or conventional antibiotics.

What is the potential of Na(+)-NQR as a target for cholera treatment?

Na+-NQR holds significant potential as a target for cholera treatment due to its essential role in V. cholerae bioenergetics and its contribution to pathogen survival during infection. Several characteristics make it particularly attractive as a therapeutic target. First, Na+-NQR is absent in humans, minimizing the risk of off-target effects and toxicity. Second, as the primary sodium pump in V. cholerae, it is crucial for maintaining appropriate intracellular sodium levels in the high-sodium environment of the intestine , making it important for pathogen survival during infection.

The enzyme's role in generating reactive oxygen species provides additional therapeutic angles. Wild-type V. cholerae produces significantly more superoxide and H₂O₂ than a Na+-NQR deletion strain , suggesting that inhibitors could potentially modulate oxidative stress in the pathogen. Strategically, treatments could either inhibit Na+-NQR function directly to compromise bacterial energetics or potentially enhance its ROS-generating properties to increase oxidative damage to the pathogen.

From a methodological perspective, developing Na+-NQR-targeted treatments would involve:

  • High-throughput screening of compound libraries against recombinant Na+-NQR

  • Structure-activity relationship studies to optimize lead compounds

  • Evaluation of efficacy in cell-based assays measuring V. cholerae growth and survival

  • Assessment of impacts on virulence factor expression

  • Testing in animal models of cholera infection

The successful expression of recombinant Na+-NQR in V. cholerae facilitates these approaches by providing both purified enzyme for screening and genetically manipulable strains for validation studies. Additionally, understanding the relationship between environmental sodium concentration and Na+-NQR activity could inform treatment strategies that consider the intestinal sodium levels during infection.

How does Na(+)-NQR research contribute to understanding bacterial bioenergetics?

Research on Na+-NQR from Vibrio cholerae makes significant contributions to our understanding of bacterial bioenergetics, particularly regarding sodium-dependent energy conservation mechanisms. Unlike the more common H+-translocating respiratory complexes, Na+-NQR represents an alternative strategy for energy conservation that couples respiratory electron transfer to sodium ion translocation. This sodium-motive force can then drive various cellular processes, demonstrating the diversity of bioenergetic mechanisms in prokaryotes.

The detailed characterization of Na+-NQR's redox components reveals unique aspects of electron transfer pathways. The enzyme contains multiple redox centers including covalently bound flavins in NqrB and NqrC and a 2Fe-2S cluster, with redox titration identifying three n = 2 redox centers and one n = 1 redox center . This cofactor arrangement differs from that of H+-translocating NADH dehydrogenases, illustrating evolutionary divergence in respiratory enzymes.

A particularly significant finding is the formation of ubisemiquinone radicals during Na+-NQR activity, with radical concentration influenced by sodium levels . This demonstrates how ion gradients can affect the redox state of electron carriers in the respiratory chain, representing a regulatory mechanism in bacterial bioenergetics. The [radical]/[Na+-NQR] ratio of up to 340:1 at high sodium concentrations indicates extensive interaction with the membrane quinone pool.

The connection between Na+-NQR activity and reactive oxygen species production provides insights into the relationship between respiratory electron transfer and oxidative stress. The finding that wild-type V. cholerae produces significantly more superoxide and H₂O₂ than a Na+-NQR deletion strain reveals how respiratory complexes can contribute to ROS generation under physiological conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.