Recombinant Vibrio cholerae serotype O1 Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression and Purification

The nqr operon (including nqrE) has been cloned and expressed in V. cholerae strains for functional studies:

  • Expression system: The operon was placed under the arabinose-inducible PBAD_{BAD} promoter in a V. cholerae Δnqr host .

  • Affinity purification: A hexahistidine tag on the C-terminus of NqrF enabled single-step purification of the recombinant complex using nickel affinity chromatography .

  • Enzyme activity: The recombinant Na+^+-NQR exhibits a turnover number of 720 electrons per second and generates a sodium gradient (ΔΨ) when reconstituted into liposomes .

Functional Significance of NqrE

NqrE contributes to the enzyme’s sodium-pumping mechanism and cellular resilience:

PropertyDetails
Na+^+ translocationDirectly involved in coupling electron transfer from NADH to Na+^+ pumping .
Metabolic impactEssential for maintaining transmembrane voltage under alkaline or hypoosmotic stress .
Virulence linkagenqr deletion reduces biofilm formation and persistence in infection models .

Key Research Findings

  • Redox coupling: NqrE’s structural flexibility enables coordination with redox centers (FAD, FMN, Fe-S clusters) to drive Na+^+ transport .

  • Inhibitor studies: The Na+^+-NQR complex, including NqrE, is a target for korormicin-inspired antibiotics, highlighting its therapeutic potential .

  • Environmental adaptation: NqrE supports V. cholerae survival in brackish water and host intestines by maintaining ion gradients critical for nutrient uptake and toxin secretion .

Evolutionary and Ecological Context

The Na+^+-NQR complex is conserved in pathogenic Vibrio species, reflecting its role in both environmental persistence (e.g., aquatic reservoirs ) and human infection. Non-toxigenic V. cholerae strains lacking nqr show reduced competitiveness in microbial communities .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preferred format in the order notes, and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping procedure utilizes normal blue ice packs. For shipments requiring dry ice, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly prior to opening to ensure all contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a final concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please communicate it to us. We will prioritize developing the specified tag whenever possible.
Synonyms
nqrE; VC_2291; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Target Names
nqrE
Target Protein Sequence
MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGIAVIVVLTISVPVNNLVY NLVLKPDALVEGVDLSFLNFITFIGVIAALVQILEMILDRFFPPLYNALGIFLPLITVNC AIFGGVSFMVQRDYSFAESVVYGFGSGVGWMLAIVALAGIREKMKYSDVPPGLRGLGITF ITAGLMALGFMSFSGVQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol in two sequential reactions. This process is coupled with the transport of Na+ ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Gene References Into Functions
  1. Identification of binding sites for ubiquinone and inhibitors in the Na(+)-pumping NADH-ubiquinone oxidoreductase from Vibrio cholerae using photoaffinity labeling PMID: 28298441
Database Links

KEGG: vch:VC2291

STRING: 243277.VC2291

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the composition and function of Na⁺-NQR in Vibrio cholerae?

Na⁺-translocating NADH:quinone oxidoreductase (Na⁺-NQR) is a membrane-associated respiratory enzyme complex composed of six subunits (NqrA-F) encoded by the nqr operon. This enzyme functions as a primary sodium pump that couples NADH oxidation to Na⁺ transport across the bacterial membrane, generating an electrochemical gradient essential for energy-consuming reactions such as flagellar motor rotation, ion homeostasis, and nutrient uptake . The enzyme represents the entry point to the respiratory chain in many pathogenic bacteria including Vibrio cholerae, Vibrio alginolyticus, and Haemophilus influenzae .

How can I express and purify recombinant Na⁺-NQR from Vibrio cholerae?

The complete six-subunit Na⁺-NQR can be expressed by cloning the nqr operon under regulation of an inducible promoter, such as the P₂ₐₚ promoter. For optimal expression and purification:

  • Construct a vector containing the entire nqr operon with a six-histidine tag on the carboxy terminus of NqrF (the last subunit in the operon)

  • Transform into a V. cholerae host strain with the genomic copy of the nqr operon deleted

  • Express the recombinant enzyme in V. cholerae

  • Solubilize membranes using appropriate detergents (dodecyl maltoside is recommended for maintaining quinone content)

  • Purify using affinity chromatography

This approach yields highly active enzyme with a turnover number of approximately 720 electrons per second for NADH consumption .

What are the key redox centers in Na⁺-NQR and how are they characterized?

Na⁺-NQR contains several redox centers that can be characterized through UV-visible spectroscopy and redox titration:

Redox CenterTypeElectron Transfer PropertiesLocation
FlavinsThree n = 2 redox centersMultiple electron transferTwo covalently bound to NqrB and NqrC
2Fe-2SOne n = 1 redox centerSingle electron transferLikely in NqrF subunit
UbiquinoneElectron acceptorTerminal electron acceptorContent varies with purification method

When purified using dodecyl maltoside (DM), the isolated enzyme contains approximately one bound ubiquinone, whereas using LDAO as a detergent results in negligible quinone content .

How do I design experiments to investigate Na⁺ pumping activity of the recombinant Na⁺-NQR?

To investigate Na⁺ pumping activity, consider the following experimental approaches:

  • Liposome Reconstitution Assay:

    • Reconstitute purified Na⁺-NQR into liposomes

    • Measure both sodium gradient formation and membrane potential (ΔΨ) generation

    • Use fluorescent dyes sensitive to Na⁺ concentration or membrane potential

  • Steady-State Kinetics:

    • Measure enzyme activity with varying Na⁺ concentrations

    • Analyze sodium-dependent stimulation of activity (up to 5-fold stimulation observed)

    • Determine Na⁺ affinity constants through enzyme kinetics

  • Control Experiments:

    • Compare wild-type activity with site-directed mutants in Na⁺-binding sites

    • Include Na⁺-independent control enzymes

    • Test the effects of known Na⁺-NQR inhibitors

For proper experimental design, follow established principles including replication, randomization, blocking, and appropriate sizing of experimental units . This ensures validity and reliability of your results.

What is known about the structural basis of Na⁺ translocation in Na⁺-NQR?

Recent cryo-electron microscopy studies have provided significant structural insights into Na⁺-NQR:

  • High-resolution (2.5-3.1 Å) cryo-EM structures of Na⁺-NQR from Vibrio cholerae both with and without bound inhibitors have been determined

  • These structures reveal the organization of the six subunits and their relationship to the membrane

  • The arrangement of redox cofactors creates an electron transfer pathway from NADH to ubiquinone

  • Specific structural elements involved in Na⁺ binding and translocation have been identified

To investigate structure-function relationships, researchers can combine these structural data with site-directed mutagenesis of putative Na⁺-binding residues, followed by functional assays to correlate structural changes with activity.

How can I analyze potential inhibitors of Na⁺-NQR as antimicrobial candidates?

Since Na⁺-NQR is exclusively found in prokaryotes, it represents a promising target for selective antibiotics . To analyze potential inhibitors:

  • Inhibitor Screening:

    • Design a high-throughput assay measuring NADH oxidation activity

    • Screen compound libraries against purified Na⁺-NQR

    • Identify compounds that significantly reduce enzyme activity

  • Binding Studies:

    • Perform structural studies of enzyme-inhibitor complexes

    • Determine binding constants using techniques such as isothermal titration calorimetry

    • Compare inhibitor binding to wild-type versus mutant enzymes

  • Antimicrobial Activity Assessment:

    • Test inhibitors against whole V. cholerae cells

    • Compare growth inhibition of wild-type versus Δnqr mutant strains

    • Assess specificity by testing activity against organisms lacking Na⁺-NQR

A similar approach has been demonstrated in the development of an in vitro proof-of-concept sense-and-kill system targeting V. cholerae , which could be adapted for inhibitor evaluation.

What are the optimal conditions for measuring Na⁺-NQR activity in vitro?

For accurate measurement of Na⁺-NQR activity:

ParameterRecommended ConditionRationale
Buffer50 mM Tris-HCl or HEPES, pH 7.5-8.0Maintains optimal pH for enzyme activity
Salt100-300 mM NaClProvides Na⁺ for transport activity
Temperature30-37°CPhysiological temperature range for V. cholerae
Electron donor50-100 μM NADHSubstrate concentration above K_m
Electron acceptor100 μM ubiquinone (Q-1 or Q-10)Terminal electron acceptor
Detergent0.05% dodecyl maltosideMaintains enzyme structure while preserving quinone content

Activity can be monitored by following NADH oxidation spectrophotometrically at 340 nm or by oxygen consumption using a Clark-type electrode (though the native enzyme has relatively low reactivity with O₂, 10-20 s⁻¹) .

How can I design redox titration experiments to characterize Na⁺-NQR electron transfer components?

Redox titration is a valuable method for characterizing the electron transfer components in Na⁺-NQR. Design your experiment following these guidelines:

  • Preparation:

    • Purify Na⁺-NQR using a method that preserves all redox centers

    • Prepare appropriate buffer systems with redox mediators covering the potential range of interest

    • Set up UV-visible spectroscopy to monitor spectral changes

  • Titration Procedure:

    • Follow protocols similar to those used in standard redox titrations

    • Incrementally change the reduction potential using suitable oxidizing or reducing agents

    • Record spectral changes at each potential point

    • Analyze data to determine midpoint potentials for each redox center

  • Analysis:

    • Plot absorbance versus potential

    • Fit data to appropriate equations (Nernst equation)

    • Determine the number of electrons transferred in each redox center

    • Previous studies have identified three n = 2 redox centers (flavins) and one n = 1 redox center (2Fe-2S)

For the endpoint detection in redox titrations, the natural color changes of transition metal ions can serve as indicators, or specific redox indicators may be employed .

What strategies can be used for site-directed mutagenesis of nqrE to investigate its role in Na⁺ translocation?

To investigate the specific role of NqrE in Na⁺ translocation:

  • Target Selection:

    • Identify conserved residues in NqrE using sequence alignments across bacterial species

    • Focus on charged or polar residues that might participate in Na⁺ binding

    • Consider residues at the membrane interface or within predicted transmembrane regions

  • Mutagenesis Approach:

    • Use PCR-based site-directed mutagenesis targeting the nqrE gene

    • Create an expression system with the mutated nqr operon

    • Express in the Δnqr V. cholerae host strain

  • Functional Analysis:

    • Compare Na⁺-dependent activity of wild-type versus mutant enzymes

    • Measure Na⁺ transport activity in liposome reconstitution assays

    • Determine changes in Na⁺ affinity or coupling efficiency

This approach allows systematic investigation of structure-function relationships in NqrE and identification of residues critical for Na⁺ binding and translocation.

How should I analyze kinetic data for Na⁺-NQR to determine the mechanism of Na⁺ coupling?

When analyzing kinetic data to understand Na⁺ coupling mechanisms:

  • Steady-State Kinetics:

    • Measure initial rates at varying concentrations of NADH and Na⁺

    • Generate double-reciprocal plots to determine the type of mechanism (sequential or ping-pong)

    • Calculate kinetic parameters (K_m, V_max) and their dependence on Na⁺ concentration

  • Statistical Analysis:

    • Apply appropriate statistical tools to evaluate your experimental data

    • Use Chi-square tests for categorical data analysis

    • Apply regression analysis for determining relationships between variables

  • Model Fitting:

    • Develop and test kinetic models that describe the coupling between electron transfer and Na⁺ transport

    • Compare models using statistical criteria (AIC, BIC)

    • Validate models with independent experiments

Previous data indicate that Na⁺-NQR exhibits up to 5-fold stimulation by sodium and functions as a primary sodium pump , suggesting a direct coupling mechanism between electron transfer and Na⁺ translocation.

What controls should be included when studying the effects of mutations in nqrE?

When studying mutations in nqrE, include these essential controls:

  • Wild-type Controls:

    • Include the wild-type enzyme in every experiment

    • Process and analyze under identical conditions as mutants

    • Use as a reference for normalizing mutant activity

  • Negative Controls:

    • Include a known inactive variant (e.g., mutation in a catalytic residue)

    • Use Δnqr strain without complementation

    • Run no-enzyme controls in activity assays

  • Conservative Mutations:

    • Create conservative amino acid substitutions (maintaining similar properties)

    • Compare with non-conservative substitutions

    • Helps distinguish between structural and functional roles

  • Complementation Controls:

    • Verify that wild-type gene complementation restores normal phenotype

    • Ensure that expression levels are comparable between wild-type and mutant proteins

    • Check protein stability and complex assembly

For experimental design, follow principles including randomization to minimize bias, blocking to control extraneous variables, and adequate replication to ensure statistical power .

How can I integrate structural and functional data to understand the role of NqrE in the Na⁺-NQR complex?

To integrate structural and functional data effectively:

  • Structure-Guided Analysis:

    • Map functional data (from mutagenesis) onto the available cryo-EM structures

    • Identify spatial relationships between NqrE and other subunits

    • Analyze potential Na⁺ translocation pathways through the complex

  • Computational Approaches:

    • Perform molecular dynamics simulations of the Na⁺-NQR complex

    • Model Na⁺ binding and translocation events

    • Calculate energetics of ion movement through potential pathways

  • Cross-Linking Studies:

    • Identify interaction partners of NqrE within the complex

    • Use chemical cross-linking followed by mass spectrometry

    • Compare cross-linking patterns in active versus inactive states

  • Evolutionary Analysis:

    • Compare NqrE sequences across bacterial species

    • Identify co-evolving residues that may be functionally linked

    • Correlate evolutionary conservation with structural and functional importance

The integration of these diverse approaches provides a comprehensive understanding of how NqrE contributes to the structure and function of the Na⁺-NQR complex in Vibrio cholerae.

How can recombinant Na⁺-NQR be utilized for screening potential antimicrobial compounds?

Given that Na⁺-NQR is exclusively found in prokaryotes, it represents a promising target for selective antibiotics . To develop a screening system:

  • High-Throughput Assay Development:

    • Design spectrophotometric assays monitoring NADH oxidation

    • Optimize for multi-well plate format

    • Include appropriate positive and negative controls

  • Screening Strategy:

    • Screen compound libraries against purified recombinant Na⁺-NQR

    • Conduct counter-screens against human enzymes to ensure selectivity

    • Validate hits with secondary assays measuring Na⁺ pumping activity

  • Lead Optimization:

    • Use structure-activity relationship studies to improve potency and selectivity

    • Test optimized compounds against whole V. cholerae cells

    • Compare effectiveness against wild-type versus Δnqr strains

This approach could identify novel antibiotic candidates specifically targeting Na⁺-NQR in pathogenic bacteria like V. cholerae .

What are the current challenges in understanding the complete mechanism of Na⁺-NQR?

Despite significant progress, several challenges remain in fully understanding Na⁺-NQR:

  • Complete Conformational Cycle:

    • Current structures provide static snapshots, but the dynamic conformational changes during the catalytic cycle remain poorly understood

    • Time-resolved structural studies are needed to capture intermediates

  • Na⁺ Binding Sites:

    • Precise localization of Na⁺ binding sites has been challenging due to the similar electron density of Na⁺ and water

    • Specialized techniques such as anomalous X-ray diffraction with heavier alkali metals may help resolve this issue

  • Proton vs. Na⁺ Specificity:

    • The molecular basis for Na⁺ versus H⁺ selectivity is not fully understood

    • Comparative studies with H⁺-pumping homologs could provide insights

  • Electron-Na⁺ Coupling Mechanism:

    • The exact mechanism coupling electron transfer to Na⁺ translocation remains elusive

    • Identification of key residues involved in coupling requires further investigation

Addressing these challenges will require innovative experimental approaches combining structural biology, biochemistry, biophysics, and computational methods.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.