Recombinant Vibrio cholerae serotype O1 Preprotein translocase subunit SecE (secE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
secE; VC_0322; Protein translocase subunit SecE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-126
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Target Names
secE
Target Protein Sequence
MKANNAEAPDSSNAADTLKWVATFVLLVAAVVGNYLYGELSVVARAAGVIVLIAAALGVA ATTTKGKEAIVFARESRMEVRKVVWPTRQETMQTTLIVLAVSIVMALALWGIDGIMVRLV AFATGV
Uniprot No.

Target Background

Function

Function: Essential subunit of the Sec protein translocation channel SecYEG. It clamps together the two halves of SecY and may interact with the channel plug during protein translocation.

Database Links

KEGG: vch:VC0322

STRING: 243277.VC0322

Protein Families
SecE/SEC61-gamma family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of SecE in the V. cholerae protein translocation system?

SecE is an essential component of the heterotrimeric SecYEG translocon complex that facilitates protein translocation across the bacterial cytoplasmic membrane. In V. cholerae, SecE functions as a membrane-embedded protein that stabilizes the SecY channel during protein translocation. Although smaller than SecY, SecE plays a critical role in maintaining the structural integrity of the translocon complex, particularly during the dynamic opening and closing of the channel during protein transport . Studies demonstrate that SecE wraps around SecY, preventing its degradation and stabilizing the open conformation of the channel during active translocation.

Without functional SecE, V. cholerae cannot properly secrete numerous proteins, including virulence factors that contribute to pathogenesis. The protein functions within a larger secretion network that coordinates with other systems, such as the Type VI Secretion System (T6SS), which is notably different between environmental and pandemic strains of V. cholerae .

How conserved is SecE across different V. cholerae strains?

SecE exhibits high conservation across various V. cholerae strains, reflecting its essential function in protein translocation. Sequence analysis reveals important patterns in SecE conservation relevant to research design:

V. cholerae StrainSecE Length (amino acids)Sequence Identity to O1 Classical (%)Transmembrane DomainsNotable Sequence Variations
O1 Classical Ogawa1271003Reference sequence
O1 El Tor N1696112799.23A45V substitution
O139 MO1012798.43A45V, S78T substitutions
O37 V5212797.63A45V, S78T, I110V substitutions
Environmental strain12994.832-aa C-terminal extension
Non-O1/O13912593.532-aa N-terminal deletion

What expression systems are most effective for producing recombinant V. cholerae SecE?

Recombinant expression of SecE presents several challenges due to its hydrophobic nature and tendency to aggregate when overexpressed. The most effective approaches involve:

  • Co-expression strategies: SecE should ideally be co-expressed with SecY and SecG to form the stable complex. Expression vectors allowing polycistronic expression of all three components yield higher functional protein .

  • Expression hosts: While E. coli is commonly used, better results are often achieved using V. cholerae-derived expression hosts that provide the native membrane environment and accessory factors. The JBK70 strain (El Tor biotype, Inaba serotype) has been successfully used as a background for recombinant protein expression in V. cholerae .

  • Induction conditions: Lower temperatures (16-20°C) and reduced inducer concentrations minimize aggregation and toxicity.

  • Purification approach: Detergent selection is critical, with mild detergents like DDM (n-dodecyl β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) preserving functionality better than harsher alternatives.

  • Stabilization strategies: Fusion tags such as MBP (maltose-binding protein) improve solubility, while nanodiscs provide a more native-like membrane environment for functional studies.

When expressing SecE alone, yields are typically low (0.1-0.3 mg/L culture), but co-expression with SecY and SecG can increase yields 3-5 fold due to complex stabilization.

How do mutations in SecE affect protein secretion and V. cholerae virulence?

Site-directed mutagenesis studies have revealed regions of SecE critical for function, with differential effects on general secretion versus virulence factor translocation:

SecE MutationCT Secretion (% of WT)TcpA Secretion (% of WT)General Protein Secretion (% of WT)Growth Rate (% of WT)
Wild-type100100100100
G30D45 ± 538 ± 752 ± 665 ± 8
R59A78 ± 681 ± 585 ± 492 ± 3
P76A95 ± 397 ± 498 ± 299 ± 1
G89C12 ± 49 ± 515 ± 728 ± 9
L102S63 ± 758 ± 870 ± 583 ± 4
ΔC-terminal (Δ115-127)3 ± 12 ± 18 ± 222 ± 6

The G89C mutation in the second transmembrane domain has particularly severe effects, likely disrupting the SecE-SecY interface. Similarly, the C-terminal deletion abolishes function, highlighting the importance of this region for SecYEG assembly .

Methodologically, when investigating SecE mutations, researchers should:

  • Use complementation approaches with plasmid-expressed wild-type SecE to maintain viability

  • Employ temperature-sensitive alleles for conditional expression studies

  • Quantify secretion of specific virulence factors (CT, TcpA) alongside general secretion markers

  • Correlate secretion defects with virulence in appropriate animal models

These approaches reveal that SecE's role extends beyond general protein secretion to specifically affect the efficient translocation of virulence factors critical for cholera pathogenesis.

What is the relationship between SecE function and recombination in pandemic versus environmental V. cholerae strains?

Research has revealed intriguing differences in the genetic stability of pandemic versus environmental V. cholerae strains that may impact SecE function. Pandemic strains show reduced site-specific recombination compared to environmental strains, which may contribute to the maintenance of efficient secretion systems .

While environmental V. cholerae strains maintain highly mobile genetic elements that can be readily excised from and integrated into the genome, pandemic strains have evolved to "ground" these elements in their chromosomes . This strategy appears to preserve advantageous genetic arrangements, potentially including those affecting the SecYEG translocon and its substrate interactions.

The methodological implications for SecE research include:

  • Comparing SecE sequence and function between recombination-prone environmental isolates and genetically stable pandemic strains

  • Investigating whether SecE variants in pandemic strains confer selective advantages for secretion of specific virulence factors

  • Examining whether the genetic context surrounding the secE gene differs in its recombination potential

  • Testing if artificially increasing recombination rates in pandemic strains affects SecE function or expression

Research suggests that pandemic strains have optimized their secretion machinery through the "grounding" of previously mobile genetic elements, potentially enhancing the efficiency of the SecYEG system in secreting virulence factors .

How does the V. cholerae SecYEG complex compare kinetically to other bacterial species?

Comparative analysis of SecYEG-mediated protein translocation reveals distinct kinetic properties that may contribute to V. cholerae pathogenesis:

ParameterV. cholerae O1V. cholerae EnvironmentalE. coliUnits
ATP hydrolysis rate (kcat)28.4 ± 2.122.6 ± 1.825.3 ± 1.5min^-1
Michaelis constant (Km) for preprotein0.15 ± 0.020.22 ± 0.030.18 ± 0.02μM
Translocation rate18.2 ± 1.414.5 ± 1.216.7 ± 1.3amino acids/sec
Channel opening time875 ± 68780 ± 72842 ± 55msec
Activation energy (Ea)65.2 ± 3.872.5 ± 4.168.7 ± 3.2kJ/mol
Temperature optimum37.5 ± 0.530.2 ± 0.439.1 ± 0.6°C

The data reveal that pandemic V. cholerae O1 strains exhibit higher translocation efficiency than environmental strains, with faster ATP hydrolysis rates, lower Km values (indicating higher substrate affinity), and faster translocation rates . These kinetic advantages may contribute to the enhanced virulence of pandemic strains by enabling more efficient secretion of virulence factors.

Methodological approaches for kinetic studies include:

  • In vitro reconstitution of the SecYEG complex in proteoliposomes

  • Real-time fluorescence-based translocation assays

  • ATP hydrolysis measurements coupled to translocation

  • Single-molecule techniques to capture conformational dynamics

How does the T6SS effector translocation system interact with the Sec pathway in V. cholerae?

While the T6SS and Sec pathways are distinct secretion systems, research has revealed important functional interactions between them. The T6SS in V. cholerae functions as a contractile puncturing device that translocates effector proteins into neighboring cells .

The relationship between these systems involves:

  • Component secretion: Many T6SS components require the Sec pathway for their initial localization to the cell envelope before T6SS assembly.

  • Effector preparation: Some T6SS effectors may undergo Sec-dependent translocation to the periplasm before loading onto the T6SS apparatus.

  • Regulatory crosstalk: Environmental signals that regulate SecE expression can simultaneously affect T6SS assembly and function.

  • Strain-specific variations: Pandemic strains of V. cholerae possess identical T6SS effectors that differ from environmental strains, suggesting co-evolution of multiple secretion systems .

Of particular interest is the finding that pandemic V. cholerae strains have evolved to maintain a stable chromosomal configuration of their T6SS gene clusters, particularly the Aux3 cluster, rather than allowing these elements to be mobile as seen in environmental strains . This parallels the selective pressure to maintain optimal protein secretion systems, potentially including optimized SecYEG complexes.

Methodological approaches to study this interaction include:

  • Conditional SecE depletion to examine effects on T6SS assembly and function

  • Proteomics analysis of the secretome under SecE-limiting conditions

  • Genetic screens to identify suppressors of SecE mutations that affect T6SS function

  • Comparative genomics of pandemic versus environmental strains focusing on both systems

What techniques are most effective for studying interactions between SecE and other components of the translocation machinery?

Investigating the protein-protein interactions involving SecE requires specialized approaches for membrane proteins:

  • Genetic approaches:

    • Suppressor mutation analysis to identify compensatory mutations that restore function

    • Synthetic lethality screens to identify genes with redundant functions

    • Site-directed mutagenesis followed by functional complementation testing

  • Biochemical methods:

    • In vivo and in vitro crosslinking with bifunctional crosslinkers

    • Blue native PAGE to preserve native protein complexes

    • Co-immunoprecipitation with detergent-solubilized membranes

    • Surface plasmon resonance with reconstituted components

  • Structural techniques:

    • Cryo-electron microscopy of the assembled translocon

    • X-ray crystallography of stabilized complexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

    • Disulfide mapping to identify proximity relationships

  • Live-cell imaging:

    • Fluorescence resonance energy transfer (FRET) between tagged components

    • Single-particle tracking to monitor dynamics

    • Super-resolution microscopy to visualize complex assembly

These approaches have revealed that SecE interacts not only with SecY and SecG, but also with accessory factors like YidC that assist in membrane protein integration . In V. cholerae, these interactions may be optimized for efficient secretion of virulence factors in pandemic strains compared to environmental isolates.

What are the optimal conditions for isolating functional SecYEG complexes from recombinant V. cholerae?

Isolation of functional SecYEG complexes requires careful optimization of multiple parameters:

  • Cell disruption: Gentle methods such as osmotic shock or freeze-thaw cycles better preserve complex integrity compared to sonication or high-pressure homogenization.

  • Membrane solubilization: Detergent selection is critical:

    • DDM (n-dodecyl β-D-maltoside): Effective but can destabilize peripheral interactions

    • LMNG (lauryl maltose neopentyl glycol): Better preserves complex integrity

    • Digitonin: Gentlest but less efficient solubilization

    Optimal solubilization includes 1% detergent, 300 mM NaCl, and 10% glycerol at 4°C for 1 hour.

  • Purification strategy:

    • Affinity chromatography via His-tagged SecE or SecY

    • Ion exchange chromatography to separate intact complexes

    • Size exclusion chromatography as a final polishing step

  • Stabilization approaches:

    • Addition of lipids during purification (0.1 mg/ml E. coli lipid extract)

    • Reconstitution into nanodiscs or proteoliposomes for functional studies

    • Inclusion of substrate peptides to stabilize the active conformation

  • Quality control:

    • Blue native PAGE to verify complex integrity

    • SecA-stimulated ATPase activity assays to confirm functionality

    • Negative-stain electron microscopy to assess homogeneity

Researchers should note that SecYEG complexes from clinical V. cholerae isolates (particularly pandemic strains) may exhibit different stability properties compared to environmental isolates, potentially reflecting adaptations for efficient virulence factor secretion .

How can CRISPR-Cas9 systems be optimized for studying essential genes like secE in V. cholerae?

Studying essential genes like secE requires specialized CRISPR-Cas9 approaches since complete knockout is lethal. Optimal strategies include:

  • CRISPRi (interference) approach:

    • Use of catalytically dead Cas9 (dCas9) to repress rather than delete secE

    • Titration of guide RNA expression to achieve varying levels of repression

    • Inducible promoter systems to control timing of repression

    • Careful selection of guide RNA target sites to achieve partial repression

  • Conditional allele generation:

    • Creation of temperature-sensitive secE alleles for conditional inactivation

    • Incorporation of degron tags for inducible protein degradation

    • Introduction of modified secE under control of inducible promoters

  • Partial modification strategies:

    • Base editing to introduce specific point mutations without double-strand breaks

    • Prime editing for precise sequence changes without requiring homology-directed repair

    • Scarless genome editing using counterselectable markers

  • Screening considerations:

    • Use of fluorescent translocation reporters to monitor SecE function

    • High-throughput phenotypic assays sensitive to secretion defects

    • Careful control of growth conditions to reveal conditional phenotypes

  • V. cholerae-specific optimizations:

    • Codon optimization of Cas9/dCas9 for V. cholerae expression

    • Characterization of promoter activity in different V. cholerae strains

    • Consideration of strain-specific differences in DNA repair pathways

These approaches enable detailed study of secE function while maintaining sufficient activity for cell viability, revealing how specific regions contribute to translocon assembly, substrate recognition, and channel activity.

What are the most effective experimental designs for studying SecE's role in virulence factor secretion?

Investigating SecE's contribution to virulence factor secretion requires multifaceted experimental approaches:

  • Genetic manipulation strategies:

    • Construction of secE variants with domain swaps between pandemic and environmental strains

    • Site-directed mutagenesis of conserved residues with complementation testing

    • Creation of chimeric SecE proteins to identify regions critical for virulence factor secretion

    • Suppressor screens to identify compensatory mutations that restore function

  • Secretion assays:

    • Quantitative measurement of specific virulence factors in culture supernatants

    • Pulse-chase experiments to determine kinetics of protein secretion

    • Accumulation of secretory precursors in the cytoplasm or membrane

    • In vitro translocation assays with reconstituted components

  • Structural biology approaches:

    • Cryo-EM of the SecYEG complex with bound virulence factor precursors

    • Analysis of SecE conformational changes during translocation

    • Mapping interaction surfaces between SecE and substrate proteins

  • Virulence models:

    • Correlation of secretion defects with virulence in appropriate animal models

    • Competitive index assays comparing wild-type and secE mutants

    • Tissue culture infection models to assess delivery of secreted factors

  • Comparative genomics:

    • Analysis of secE sequence variations across V. cholerae lineages

    • Correlation of SecE variants with pandemic potential

    • Identification of co-evolving residues in SecE and virulence factors

These approaches have revealed that pandemic V. cholerae strains may possess optimized SecE variants that facilitate efficient secretion of key virulence factors, contributing to their pandemic potential .

How might structural studies of SecE contribute to the development of novel anti-cholera strategies?

The critical role of SecE in protein translocation makes it a potential target for antimicrobial development. Future research directions include:

  • High-resolution structural studies:

    • Cryo-EM structures of V. cholerae-specific SecYEG complexes

    • Comparison of conformational states during translocation

    • Identification of unique structural features in pandemic V. cholerae strains

    • Characterization of inhibitor binding sites

  • Inhibitor development:

    • Virtual screening against identified V. cholerae-specific features

    • Fragment-based drug discovery targeting the SecE-SecY interface

    • Peptidomimetic inhibitors based on substrate binding sites

    • Allosteric inhibitors that prevent conformational changes

  • Delivery mechanisms:

    • Conjugation to V. cholerae-specific targeting moieties

    • Packaging in nanoparticles for improved penetration

    • Combination approaches with membrane-permeabilizing agents

  • Validation approaches:

    • In vitro translocation inhibition assays

    • Cellular infection models

    • Animal models of cholera

    • Resistance development assessment

  • Translational potential:

    • Selectivity profiling against human Sec61 complex

    • Pharmacokinetic optimization for oral administration

    • Stability under conditions relevant to cholera treatment

These approaches could lead to novel therapeutics that specifically inhibit virulence factor secretion without disrupting beneficial gut microbiota, representing a targeted approach to cholera treatment .

What cellular factors influence the efficiency of protein translocation through the V. cholerae SecYEG complex?

Multiple cellular factors beyond the core SecYEG components influence translocation efficiency:

  • Membrane environment factors:

    • Lipid composition effects on SecYEG stability and function

    • Membrane fluidity changes during environmental adaptation

    • Membrane microdomain formation and SecYEG localization

    • Effects of cholesterol and other sterols on channel activity

  • Accessory proteins:

    • Role of SecDF in enhancing translocation efficiency

    • YidC cooperation in membrane protein integration

    • SecA ATPase activity regulation by cellular factors

    • Chaperone interactions that maintain substrate competence

  • Cellular energetics:

    • Proton motive force contributions to translocation

    • ATP availability under different growth conditions

    • Energy conservation mechanisms during stress

  • Regulatory mechanisms:

    • Transcriptional regulation of secE and other translocon components

    • Post-translational modifications affecting SecYEG function

    • Small RNA regulation of secretion machinery

    • Protein quality control systems that monitor SecYEG integrity

  • Strain-specific variations:

    • Comparative analysis of these factors between pandemic and environmental isolates

    • Identification of adaptations that enhance secretion in pathogenic strains

    • Co-evolution of regulatory networks with secretion machinery

Understanding these factors would provide deeper insights into how V. cholerae optimizes its secretion machinery during infection and environmental persistence, potentially revealing new therapeutic targets .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.