Recombinant Vibrio cholerae serotype O1 Probable D-methionine transport system permease protein metI (metI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will prioritize its development for your order.
Synonyms
metI; VC_0906; Probable D-methionine transport system permease protein MetI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Target Names
metI
Target Protein Sequence
MSFNTIAQWFALNSDLLLTATWQTLYMVAIAGAVGFALGIPLGVILHTTKKEGLLENLPL NRALGAVVNIGRSVPFLVLMVAIIPVTKLIVGTFIGTTAAIVPLTIGAIPFVARLIESAL LEVPTGLVEAAQSMGATPLQIIRKVLLPEALPTILNSVTITLVTLVSYSAMAGTVGGGGL GDVAIRYGFHRYDITIMAVTVVMLIVLVQIIQSIGDALVRRVDHR
Uniprot No.

Target Background

Function
This protein is a component of the binding-protein-dependent transport system for D-methionine. It is likely responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: vch:VC0906

STRING: 243277.VC0906

Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MetI and what is its role in Vibrio cholerae?

MetI is a permease protein component of the high-affinity methionine transport system (MetD) in Vibrio cholerae. It functions as part of the MetNI transporter complex, which is responsible for the uptake of methionine into the bacterial cell . This ATP-binding cassette (ABC) transporter system is essential for V. cholerae to acquire methionine from its environment, particularly in nutrient-limited conditions such as those found in the host intestine. The MetNI transporter specifically plays a crucial role in the transport of both L-methionine and D-methionine derivatives, with D-methionine transport being exclusively mediated by the MetD system (MetNIQ operon) . The proper functioning of the MetI permease is critical for bacterial survival and virulence in host environments where methionine availability may be limited.

How does methionine availability affect V. cholerae colonization and virulence?

Methionine availability significantly impacts V. cholerae's ability to colonize and establish infection in the host intestine. Research has demonstrated that high-affinity methionine transport is essential for V. cholerae growth in the Drosophila intestine when de novo synthesis is absent . Experimental evidence shows that mutants deficient in high-affinity methionine transporters (MetI and MetT) exhibit severe colonization defects in animal models, which can be rescued by methionine supplementation .

What is the relationship between the methionine regulator MetR and MetI in V. cholerae?

The MetR protein serves as a transcriptional regulator of methionine metabolism in V. cholerae and has been identified as a critical virulence regulator . Disruption of MetR severely affects intestinal colonization in the suckling mouse model of cholera . While MetR directly regulates several genes involved in methionine metabolism, including metA, metE, metH, and glyA1, its relationship with metI is part of a broader regulatory network affecting methionine transport and utilization .

The MetR regulon includes components necessary for both methionine synthesis and transport. When MetR function is compromised, the resulting misregulation impacts V. cholerae's ability to acquire and utilize methionine efficiently. Chromatin immunoprecipitation experiments with epitope-tagged MetR have confirmed its binding to the promoter regions of several methionine-related genes, highlighting the direct regulatory relationships within this metabolic pathway . Understanding the MetR-MetI regulatory relationship is essential for comprehending how V. cholerae adapts its metabolism during host colonization.

What methodological approaches can be used to generate and study metI deletion mutants in V. cholerae?

Creating metI deletion mutants in V. cholerae requires precise genetic manipulation techniques. Based on established protocols, researchers typically employ one of two main approaches:

  • Splicing by Overlap Extension (SOE) technique: This method involves generating overlapping fragments with complementary sequences at their 3′ and 5′ ends. These fragments are joined together to create an in-frame deletion in the metI gene. The resulting fragment can be ligated into a suicide plasmid such as pWM91 .

  • Gibson Assembly: For an alternative approach, inner primers with 20-bp complementary sequences at their 3′ and 5′ ends are used to permit Gibson assembly. The two fragments are then ligated with a suicide vector (like pWM91) following the manufacturer's instructions .

Once the deletion construct is created, gene deletions can be introduced into the relevant V. cholerae strains through double homologous recombination and sucrose selection . Verification of the deletion can be performed through PCR amplification and sequencing of the targeted region.

For functional studies, these metI mutants can be evaluated in comparison to wild-type strains using colonization assays, growth curves with varying methionine concentrations, or in vivo infection models such as the Drosophila intestine model or the infant mouse model .

How can the transport activity of MetI be quantitatively assessed in experimental systems?

The transport activity of MetI can be quantitatively assessed through several experimental approaches:

  • Substrate uptake assays: To specifically study MetI transport function, researchers can utilize the exclusive role of the MetD system in D-methionine transport. By using D-methionine derivatives such as D-selenomethionine (D-semet) as transport substrates, uptake can be quantified by inductively coupled plasma-mass spectrometry (ICP-MS) .

  • Kinetic analysis: Transport kinetics can be determined by measuring substrate uptake at various concentrations and fitting the data to Michaelis-Menten kinetics. Key parameters to determine include:

    • Maximal uptake rate (Vmax) expressed as nmol·min⁻¹·mg⁻¹ of transporter

    • Michaelis-Menten constant (Km) to understand transport affinity

  • Genetic complementation studies: The function of MetI can be assessed by complementation experiments where the wild-type metI gene is reintroduced into metI deletion mutants to determine if normal transport function is restored .

  • In vivo colonization assays: The functional significance of MetI can be assessed using animal models such as Drosophila, where intestinal colonization is measured after continuous feeding or washout periods. By comparing colonization levels of wild-type V. cholerae with metI deletion mutants, researchers can evaluate the in vivo importance of this transporter .

  • Methionine rescue experiments: Supplementing growth media or animal models with exogenous methionine can help determine if colonization defects in metI mutants are specifically due to methionine transport deficiencies rather than other effects .

What is the structural basis for substrate specificity in the MetNIQ transport system, and how does MetI contribute?

The structural basis for substrate specificity in the MetNIQ transport system involves complex interactions between the permease components (including MetI), the nucleotide-binding domains, and the substrate-binding protein MetQ. Key structural insights include:

  • Channel formation: MetI, as part of the permease component, forms the transmembrane translocation pathway through which methionine derivatives are transported . Crystal structures of the complete MetNIQ complex in the outward-facing conformation (PDB ID code 6CVL) have revealed how these components interact to create the substrate translocation pathway .

  • Conformational changes: The MetNIQ complex undergoes significant conformational changes during the transport cycle. In the outward-facing conformation, access channels form through the MetQ binding protein to the transmembrane translocation pathway, facilitating substrate entry .

  • Dual mechanism of substrate uptake: The MetNIQ system appears to support two distinct mechanisms for substrate uptake:

    • A canonical mechanism where methionine-bound MetQ delivers substrate from the periplasm to the transporter

    • A noncanonical mechanism where apo MetQ facilitates ligand binding when complexed to the transporter

  • Substrate specificity determinants: Experiments with substrate-binding deficient variants of MetQ (such as N229A) have provided insights into how substrate specificity is achieved. Surprisingly, some substrate-binding deficient variants actually support higher transport rates for certain substrates like D-selenomethionine . This suggests that direct access of substrates to the translocation pathway may occur under certain conditions.

These structural features enable the MetNIQ system to transport both high-affinity substrates (like L-methionine) and lower-affinity substrates (like D-methionine derivatives) across a physiological concentration range, with MetI playing a central role in forming the transmembrane pathway .

How does methionine transport via MetI interact with methionine sulfoxide metabolism in V. cholerae?

Methionine transport via MetI and methionine sulfoxide metabolism represent interconnected systems that contribute to V. cholerae's adaptive responses in oxidative environments. The relationship between these processes involves:

  • Methionine sulfoxide reductase system: V. cholerae encodes five methionine sulfoxide reductases (Msrs) that catalyze the reduction of methionine sulfoxide back to methionine . These include homologs of MsrA, MsrB, and MsrC, with different specificities for the R and S diastereomers of methionine sulfoxide.

  • Cellular localization and function: Only the MsrAB homolog includes a signal sequence and transmembrane domain, suggesting it is anchored in the inner membrane and functions in the periplasm . This positioning may enable coordination with membrane-bound transport systems like MetI.

  • Diastereomer specificity: Research has shown that of the five Msr homologs in V. cholerae, only MsrC can reduce L-Met-O . Experimental evidence from deletion mutants demonstrates that:

    • Single or combined deletions of genes encoding MsrAs and MsrBs do not alter growth on L-Met-R,S-O

    • When msrC is deleted in these backgrounds, V. cholerae can no longer grow on L-Met-R,S-O

    • All mutants unable to grow on L-Met-R,S-O can be rescued by methionine supplementation

  • Functional significance in colonization: While high-affinity methionine transport through systems including MetI is essential for V. cholerae growth in the Drosophila intestine in the absence of synthesis, the reduction of methionine sulfoxide appears less critical for intestinal colonization . This suggests differential importance of these systems in the host environment.

These interactions highlight the complex metabolic adaptations V. cholerae employs to utilize available methionine sources under various environmental conditions, with MetI playing an essential role in acquiring the necessary methionine for bacterial growth and virulence.

What are the optimal conditions for expressing and purifying recombinant MetI for structural and functional studies?

Expression and purification of recombinant MetI presents several challenges due to its membrane-embedded nature. Based on established protocols for similar membrane proteins and ABC transporters, the following approach is recommended:

  • Expression system selection:

    • For initial expression trials, E. coli is typically the preferred host, particularly strains optimized for membrane protein expression such as C41(DE3) or C43(DE3)

    • Expression vectors containing strong inducible promoters (T7, ara) with appropriate fusion tags (His6, FLAG, or MBP) facilitate purification and detection

    • For structural studies, constructs deposited in Addgene (ID codes 118253, 118254, 118256-118261, and 118581) have been successfully used for transport assays

  • Expression conditions:

    • Growth temperature: Lower temperatures (16-18°C) after induction help prevent aggregation

    • Induction: Use of mild induction conditions with reduced IPTG concentrations (0.1-0.5 mM) or arabinose (0.002-0.02%)

    • Media supplementation: Addition of glycerol (0.5-1%) can stabilize membrane proteins during expression

  • Membrane preparation and solubilization:

    • Cell disruption via French press or sonication in buffer containing protease inhibitors

    • Membrane fraction isolation through differential centrifugation

    • Solubilization using mild detergents such as n-dodecyl-β-D-maltopyranoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin

  • Purification strategy:

    • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or TALON resin

    • Secondary purification: Size exclusion chromatography to separate aggregates and obtain homogeneous protein

    • For structural studies, reconstitution into nanodiscs or incorporation into lipid cubic phase may enhance stability

  • Quality control assessments:

    • SDS-PAGE and Western blotting to confirm identity and purity

    • Dynamic light scattering to assess homogeneity

    • Circular dichroism to verify proper folding

    • Functional assays such as ATPase activity or reconstitution into liposomes for transport assays

For structural studies specifically, the conditions used to obtain the MetNIQ complex crystal structure (PDB ID code 6CVL) provide a validated approach for successful expression and purification of functional protein .

How can researchers differentiate between the roles of MetI and other methionine transporters in V. cholerae?

Differentiating between the roles of MetI and other methionine transporters in V. cholerae requires strategic experimental approaches:

  • Selective substrate utilization:

    • The MetD system (which includes MetI) is exclusively responsible for D-methionine transport, while both MetD and the lower-affinity MetP system transport L-methionine

    • Using D-methionine or its derivatives (such as D-selenomethionine) allows researchers to specifically study MetI-dependent transport without interference from other systems

  • Genetic manipulation strategies:

    • Single and combined deletion mutants of metI, metN, metQ, and other transport components help delineate their specific contributions

    • The ΔmetNIQ knockout E. coli strain has been effectively used to study MetNI transport function in isolation

    • For V. cholerae, mutants such as ΔmetR ΔmetI ΔmetT have been employed to study the combined effects of regulator and transporter deletions

  • Transport kinetics analysis:

    • Determining kinetic parameters (Vmax, Km) for different substrates helps differentiate the contributions of various transport systems

    • The MetNI system has been characterized with a Km of approximately 1.8 μM for D-selenomethionine and a Vmax of 6.3 ± 0.4 nmol·min⁻¹·mg⁻¹ of transporter

    • These parameters can be compared between different mutant strains to assess the contribution of each component

  • Regulation studies:

    • Investigating the differential regulation of transport systems helps understand their specialized roles

    • MetR has been identified as a key regulator of methionine metabolism in V. cholerae, and its interactions with various promoters can be studied through chromatin immunoprecipitation and quantitative PCR

  • In vivo competition assays:

    • Co-infection experiments with wild-type and transport-deficient mutants in animal models can reveal competitive advantages

    • These approaches have demonstrated that high-affinity methionine transport is essential for V. cholerae colonization in the Drosophila intestine when methionine synthesis is impaired

By combining these approaches, researchers can build a comprehensive understanding of the specific role of MetI in relation to other methionine transporters in V. cholerae.

What are the implications of MetI function for developing novel antimicrobial strategies against V. cholerae?

The essential role of MetI in methionine transport presents several promising avenues for antimicrobial development:

  • Transport inhibition as a therapeutic strategy:

    • Since high-affinity methionine transport is essential for V. cholerae colonization in the absence of synthesis , small molecules that specifically inhibit MetI function could effectively restrict bacterial growth in the intestinal environment

    • Structural information from the MetNIQ complex (PDB ID code 6CVL) provides a foundation for structure-based drug design targeting critical residues in the translocation pathway

  • Targeting regulatory networks:

    • MetR has been identified as a virulence regulator in V. cholerae , and disruption of its function severely affects intestinal colonization

    • Compounds that interfere with MetR-DNA interactions could simultaneously affect multiple virulence-associated pathways, including methionine transport

    • Chromatin immunoprecipitation data identifying MetR binding sites provides potential molecular targets for such inhibitors

  • Exploiting substrate specificity:

    • The MetNI system's ability to transport toxic methionine analogs could be leveraged to deliver antimicrobial compounds

    • Understanding the noncanonical mechanism where apo MetQ facilitates ligand binding offers insights into designing substrate analogs that might preferentially enter through this pathway

  • Combination therapies:

    • Inhibitors targeting both methionine transport (via MetI) and synthesis pathways could create a synergistic effect, preventing bacterial adaptation

    • Since the ΔmetR ΔmetI ΔmetT mutant shows severe colonization defects , multi-target approaches affecting both regulation and transport may be particularly effective

  • Host-directed strategies:

    • Manipulating methionine availability in the intestinal environment through dietary interventions or microbiome modulation might complement direct antimicrobial approaches

    • Understanding the methionine concentration in the intestine (estimated at 0.05-0.5 mM from Drosophila studies) provides context for such interventions

These approaches represent promising directions for developing novel antimicrobial strategies that exploit the dependency of V. cholerae on functional methionine transport systems for successful host colonization and virulence.

What are common challenges in studying MetI function and how can they be overcome?

Researchers studying MetI function face several technical challenges that require specific troubleshooting approaches:

  • Membrane protein expression difficulties:

    • Challenge: Overexpression of membrane proteins like MetI often leads to toxicity, aggregation, or inclusion body formation

    • Solution: Optimize expression using specialized strains (C41/C43), lower temperatures (16-18°C), reduced inducer concentrations, and addition of membrane-stabilizing agents like glycerol

  • Functional assay limitations:

    • Challenge: Direct measurement of MetI-specific transport can be complicated by redundant transport systems

    • Solution: Leverage the exclusive role of MetD in D-methionine transport by using D-selenomethionine as a substrate that can be quantified by ICP-MS

  • Complex genetic interactions:

    • Challenge: Methionine transport involves multiple components (MetN, MetI, MetQ) with complex interactions

    • Solution: Create defined genetic backgrounds through precise deletion mutants using techniques like splicing by overlap extension or Gibson assembly , then conduct complementation studies

  • In vivo relevance determination:

    • Challenge: Translating in vitro findings to in vivo significance

    • Solution: Use animal models such as the Drosophila intestine model or infant mouse model with continuous feeding followed by washout periods to assess colonization capabilities

  • Regulatory network complexity:

    • Challenge: Untangling the regulatory relationships affecting MetI expression and function

    • Solution: Employ chromatin immunoprecipitation followed by qPCR or sequencing to identify direct regulatory interactions, as demonstrated with MetR

  • Structural characterization barriers:

    • Challenge: Obtaining structural information for membrane proteins

    • Solution: Utilize stabilizing mutations (such as N295A E166Q in MetNI) that have proven successful in previous structural studies

  • Detecting low-level expression:

    • Challenge: Measuring physiological levels of MetI expression

    • Solution: Develop sensitive detection methods such as epitope tagging (like the 3xV5 tag used for MetR) combined with western blotting or mass spectrometry

By anticipating these challenges and implementing the suggested solutions, researchers can more effectively investigate MetI function in V. cholerae and its role in bacterial pathogenesis.

What are the appropriate controls and experimental designs for evaluating recombinant MetI activity?

Rigorous evaluation of recombinant MetI activity requires careful experimental design and appropriate controls:

  • Essential negative controls:

    • ΔmetNIQ knockout strain without complementation to establish baseline transport levels

    • Heat-inactivated protein preparations to confirm activity is enzyme-dependent

    • Non-methionine substrates to verify transport specificity

    • ATP-binding site mutants (such as the E166Q variant) to confirm ATP-dependence of transport

  • Positive controls and benchmarks:

    • Wild-type MetNIQ system expressed under identical conditions for direct comparison

    • Known functional variants like N295A MetNI for comparison to previously characterized transport rates

    • Rescue experiments with methionine supplementation to confirm specificity of observed phenotypes

  • Substrate concentration considerations:

    • Transport assays should include a range of substrate concentrations (typically 0.1-100 μM) to allow for Michaelis-Menten kinetic analysis

    • Physiologically relevant concentrations (0.05-0.5 mM) should be included based on estimated intestinal methionine levels

  • Time-course experiments:

    • Initial rate measurements (early time points) to determine true transport rates before equilibrium

    • Extended time courses to evaluate accumulation capacities and potential efflux

  • Environmental variable testing:

    • pH range experiments to determine optimal conditions and physiological relevance

    • Temperature dependence studies to characterize activation energy requirements

    • Metal ion requirements or inhibition studies

  • Validation through multiple techniques:

    • Direct transport measurements using radiolabeled or derivatized substrates like D-selenomethionine

    • ATPase activity assays as an indirect measure of transport function

    • Growth complementation assays in methionine auxotrophs

    • In vivo colonization assays in animal models

  • Structure-function verification:

    • Site-directed mutagenesis of key residues identified from structural studies

    • Comparison of recombinant protein activity with published kinetic parameters:

      • Wild-type MetNIQ: Vmax = 6.3 ± 0.4 nmol·min⁻¹·mg⁻¹, Km = 1.8 μM

      • N295A MetNIQ: Vmax = 10 ± 0.5 nmol·min⁻¹·mg⁻¹, Km = 1.7 μM

These controls and experimental designs ensure that the observed activities can be confidently attributed to MetI function and provide a comprehensive characterization of its transport properties.

What are the most promising areas for future research on MetI and methionine transport in V. cholerae?

Several high-potential research directions could significantly advance our understanding of MetI and methionine transport in V. cholerae:

  • High-resolution structural studies:

    • Cryo-electron microscopy of the MetNIQ complex in different conformational states to understand the complete transport cycle

    • Structure-guided mutagenesis to identify critical residues for substrate specificity and translocation

    • Molecular dynamics simulations to elucidate the mechanism of substrate passage through the permease channel

  • In vivo methionine metabolism mapping:

    • Development of biosensors to measure real-time methionine concentrations in the intestinal environment

    • Metabolomic analysis to characterize the methionine pool available to V. cholerae during infection

    • Isotope labeling studies to track methionine utilization pathways during host colonization

  • Regulatory network integration:

    • Systems biology approaches to understand how MetR regulation coordinates with other virulence regulatory networks

    • Investigation of environmental signals that modulate methionine transport activity in host environments

    • Identification of small RNAs or post-translational modifications that might regulate MetI expression or function

  • Host-pathogen interface exploration:

    • Examination of how host nutritional immunity might restrict methionine availability during infection

    • Study of how intestinal inflammation affects methionine transport requirements

    • Investigation of microbiome influences on methionine availability and V. cholerae colonization

  • Therapeutic development:

    • High-throughput screening for MetI inhibitors using transport assays with D-selenomethionine

    • Structure-based design of MetNIQ complex inhibitors targeting the substrate translocation pathway

    • Development of methionine analogs that can enter through the MetNIQ system but disrupt bacterial metabolism

  • Methodological advances:

    • Development of improved genetic tools for studying methionine transport in V. cholerae

    • Creation of fluorescent or bioluminescent reporters to monitor MetI expression and activity in vivo

    • Adaptation of single-molecule techniques to study the dynamics of the MetNIQ complex

These research directions hold significant promise for advancing our understanding of methionine transport in V. cholerae and potentially yielding new strategies for cholera prevention or treatment.

How does understanding MetI function contribute to the broader field of bacterial pathogenesis?

Research on MetI and methionine transport systems provides valuable insights into broader concepts in bacterial pathogenesis:

  • Metabolic adaptation during infection:

    • MetI function exemplifies how pathogens adapt their metabolic machinery to nutrient-limited host environments

    • The dual role of the MetNIQ system in transporting both high and low-affinity substrates demonstrates metabolic flexibility

    • This research highlights the intersection between basic metabolism and virulence, showing how nutritional requirements shape pathogen evolution

  • Regulatory network integration:

    • The identification of MetR as both a metabolic regulator and virulence factor demonstrates how bacteria integrate multiple cellular processes during infection

    • Understanding these integrated networks provides a more holistic view of pathogenesis beyond classical virulence factors

  • Therapeutic target identification:

    • Essential metabolic transporters like MetI represent promising antimicrobial targets that may be less susceptible to resistance development

    • The specificity of systems like MetD for D-methionine transport offers opportunities for targeted therapeutic approaches

  • Host-pathogen nutritional competition:

    • MetI function highlights the competition between host and pathogen for essential nutrients like methionine

    • This concept of "nutritional immunity" extends beyond well-studied metal sequestration to include amino acid availability

  • Microbiome interactions:

    • Understanding methionine transport helps explain how gut microbiota composition might influence susceptibility to enteric pathogens

    • Differences in Clostridiales and Enterobacterales abundance have been associated with V. cholerae-specific immune responses , potentially relating to methionine availability

  • Evolution of virulence mechanisms:

    • The dual role of MetQ in substrate transport showcases how seemingly basic cellular functions can evolve specialized mechanisms

    • This exemplifies how pathogens optimize core cellular processes for virulence without requiring dedicated virulence factors

  • Methodological advances in pathogenesis research:

    • Approaches used to study MetI, such as in vivo colonization assays and targeted metabolite analysis, provide templates for investigating other metabolic systems in pathogens

    • The regulator-centric approach used to identify MetR as a virulence regulator offers an efficient strategy for discovering new virulence mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.