Recombinant Vibrio cholerae serotype O1 Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your preferred tag type in advance for prioritized development.
Synonyms
ubiB; VC0395_A2430; VC395_0095; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-544
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Target Names
ubiB
Target Protein Sequence
MKPAELKRLYRIVKVQLEYGLDELLPEHHLTRAPLLARKSLFWLRNQHADKALGDRLRLA LQELGPVWIKFGQMMSTRRDLFPPYIADPLAMLQDKVAPFDGLQAKQLIEEELGAPLETW FDDFDIKPLASASIAQVHTAKLKSNGRDVVLKVIRPDIRPQIDADIKLMYRVARIVAKAL PEARRLKPVEVVREYEKTLLDELDLRREAANAIQLRRNFENSEELYVPEVLTDFCNETVM VSERIYGIQVSDLAGLHANGTNMKLLAERGVSVFFTQVFRDSFFHADMHPGNVFVNPNHP ENPQWIGLDCGIVGTLNSEDKRYLAENFLAFFNRDYRRVAQLHVDSGWVPLDTNVDEFEV AIRMVCEPIFAKPLCEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGLGRQLYP QLDLWQTAKPFLEKWMANQVGPQAFLHALKERAPLWFEKMPELPELLYDSLKQGRNLNQR LDNLYQGYRQSKRQQGTGKFLFGVGATLVVCSAIWISNQLEPLAIGSATIGVLCWLLSWR AYRQ
Uniprot No.

Target Background

Function
This protein is likely a kinase regulator of UbiI, an enzyme involved in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of UbiB in ubiquinone biosynthesis in Vibrio cholerae?

UbiB functions as a critical component in the ubiquinone (UQ) biosynthetic pathway in prokaryotes including Vibrio cholerae. The protein possesses ATPase activity that is essential for specific steps in the UQ biosynthesis process . Ubiquinone biosynthesis requires a total of eight reactions to modify the aromatic ring of the precursor 4-hydroxybenzoic acid (4-HB), including prenylation, decarboxylation, three hydroxylation reactions, and three methylation reactions . UbiB appears to be one of three accessory factors (along with UbiJ and UbiK) that are necessary for this pathway to function properly. While specific biochemical details of UbiB in V. cholerae are not fully characterized, comparative analysis with other proteobacteria suggests it plays an important role in the oxygen-dependent pathway of ubiquinone production .

How does UbiB contribute to V. cholerae metabolic adaptability?

UbiB's role in ubiquinone biosynthesis directly contributes to V. cholerae's ability to adapt to environments with varying oxygen levels. Ubiquinone serves as the terminal electron acceptor in aerobic respiration, making it essential for energy production under aerobic conditions . The presence of both oxygen-dependent and oxygen-independent pathways for ubiquinone biosynthesis in proteobacteria like V. cholerae suggests that these bacteria have evolved sophisticated metabolic mechanisms to thrive across diverse ecological niches with fluctuating oxygen availability . This metabolic flexibility likely contributes to V. cholerae's success as both an environmental bacterium and a human pathogen. The ability to maintain ubiquinone production under varying oxygen conditions may be particularly important during infection, where bacteria encounter oxygen gradients within the intestinal environment.

How is the ubiB gene regulated in V. cholerae?

While direct data on ubiB regulation in V. cholerae is limited in the provided search results, research on coexpression networks suggests that metabolic genes in V. cholerae often display coordinated expression patterns . Based on coexpression analysis approaches, ubiB regulation likely involves integration with other metabolic pathways, particularly those related to energy production and adaptation to environmental conditions. Comprehensive coexpression network analysis has been successful in identifying regulatory relationships between genes in V. cholerae, clarifying results from previous sequencing experiments, and expanding upon findings in related Gram-negative bacteria . These approaches can provide valuable insights into the regulatory networks governing ubiB expression in different environmental contexts and during infection.

What methods are most effective for recombinant expression and purification of V. cholerae UbiB?

The recombinant expression of V. cholerae UbiB requires careful consideration of several factors to ensure proper protein folding and activity. Based on methodological approaches used for other V. cholerae proteins, effective recombinant expression typically involves:

  • Expression system selection: E. coli BL21(DE3) is commonly used for expression of V. cholerae proteins, with pET vector systems allowing for controlled induction using IPTG.

  • Optimization of induction conditions: Temperature, IPTG concentration, and induction duration significantly impact protein solubility and yield. For membrane-associated proteins like UbiB, lower induction temperatures (16-20°C) often improve proper folding.

  • Purification strategy:

    • Initial clarification through centrifugation to separate soluble and insoluble fractions

    • Affinity chromatography using histidine tags for initial capture

    • Size exclusion chromatography for final purification and buffer exchange

    • For activity studies, careful consideration of detergent selection is critical if UbiB is membrane-associated

  • Activity preservation: Inclusion of appropriate cofactors and stabilizing agents in purification buffers to maintain the ATPase activity of UbiB .

The purification protocol must be optimized specifically for UbiB to maintain its native conformation and enzymatic activity, particularly given its potential membrane association and ATPase functionality.

How does UbiB interact with other components of the ubiquinone biosynthesis pathway?

UbiB likely functions within a multi-protein complex involved in ubiquinone biosynthesis. In related systems, UbiB works alongside other accessory factors such as UbiJ and UbiK, which belong to a multiprotein UQ biosynthesis complex . The SCP2 domain (sterol carrier protein 2) of UbiJ binds the hydrophobic UQ biosynthetic intermediates, suggesting that these proteins collectively coordinate the efficient processing of these intermediates .

For V. cholerae specifically, guilt-by-association approaches using coexpression network analysis can help identify potential interaction partners of UbiB . These approaches have successfully identified functional relationships between genes involved in the same biological processes in V. cholerae, such as biofilm formation and virulence regulation . Applied to UbiB, this methodology could potentially reveal interaction partners within the ubiquinone biosynthesis pathway and beyond.

Research into the protein-protein interactions of UbiB should consider:

  • Affinity purification coupled with mass spectrometry

  • Bacterial two-hybrid systems

  • Co-immunoprecipitation experiments

  • Cross-linking studies to capture transient interactions

How does oxygen availability affect UbiB function and ubiquinone production in V. cholerae?

Oxygen availability significantly impacts ubiquinone biosynthesis pathways in proteobacteria. While UbiB is involved in the O₂-dependent pathway for ubiquinone biosynthesis, proteobacteria like E. coli (and likely V. cholerae) possess both O₂-dependent and O₂-independent pathways . The existence of these dual pathways enables these bacteria to synthesize ubiquinone across the entire range of environmental O₂ levels they may encounter.

In oxygen-limited conditions, the O₂-independent pathway that utilizes UbiT, UbiU, and UbiV proteins becomes essential . UbiU and UbiV form a heterodimer containing 4Fe-4S clusters that are crucial for their O₂-independent hydroxylase activity . The interplay between these two pathways and how they are regulated based on oxygen availability represents an important area for further research.

Methodological approaches to study this relationship should include:

  • Growth studies under precisely controlled oxygen conditions

  • Quantification of ubiquinone production under varying oxygen levels

  • Transcript and protein abundance analysis of both pathways

  • Genetic manipulation to create pathway-specific knockouts

How do mutations in ubiB affect V. cholerae pathogenicity and biofilm formation?

The relationship between ubiquinone biosynthesis and V. cholerae pathogenicity remains an important research question. While direct evidence linking UbiB to virulence is limited in the search results, several connections can be hypothesized:

  • Energy metabolism and virulence: Disruption of ubiquinone biosynthesis through ubiB mutations would likely impact energy generation, potentially affecting virulence factor production and secretion systems that require ATP.

  • Biofilm formation: V. cholerae forms biofilms as a protective measure against environmental and host hazards . The underlying structure of biofilms consists of secreted macromolecules, including the exopolysaccharide VPS (Vibrio polysaccharide) . Energy metabolism disruptions from ubiB mutations could potentially impact biofilm formation processes.

  • Adaptation to host environments: The ability to synthesize ubiquinone under varying oxygen conditions may be crucial for V. cholerae's adaptation to different microenvironments within the host intestine, where oxygen gradients exist .

To investigate these relationships, researchers should consider:

  • Constructing defined ubiB mutants and assessing their virulence in appropriate animal models

  • Evaluating biofilm formation capacity in ubiB mutants

  • Examining expression of virulence genes in ubiB mutants

  • Assessing colonization ability in oxygen-gradient environments

What are the most effective assays for measuring UbiB activity in vitro?

Measuring UbiB activity requires specialized assays that account for its ATPase functionality. Based on approaches used for related proteins, effective assays include:

  • ATPase activity measurement:

    • Colorimetric phosphate detection using malachite green or molybdate-based assays

    • Coupled-enzyme assays that link ATP hydrolysis to NAD(P)H oxidation

    • Radioactive assays using γ-³²P-ATP

  • Protein-substrate interaction assessment:

    • Binding assays with predicted substrates using isothermal titration calorimetry (ITC)

    • Surface plasmon resonance (SPR) to measure binding kinetics

    • Fluorescence-based assays to monitor conformational changes upon substrate binding

  • Functional complementation:

    • Rescue experiments in ubiB knockout strains to assess functionality of recombinant variants

Assay TypePrincipleAdvantagesLimitations
Malachite Green ATPase AssayColorimetric detection of free phosphateSimple, quantitative, high-throughput compatibleEndpoint measurement, potential interference
Coupled-Enzyme AssayLinks ATP hydrolysis to NADH oxidationContinuous measurement, high sensitivityComplex setup, potential for false positives
Radioactive AssayDirect detection of ³²P releaseHighly sensitive, specificRequires radioisotope handling, not high-throughput
Thermal Shift AssayMeasures protein stabilization upon ligand bindingRapid screening of conditions/ligandsIndirect measure of activity

When designing these assays, careful consideration must be given to buffer conditions, particularly the presence of detergents if UbiB is membrane-associated, and the inclusion of appropriate metal cofactors that may be required for activity.

How can researchers effectively analyze the impact of ubiB mutation on the V. cholerae metabolome?

Metabolomic analysis of ubiB mutants requires a comprehensive approach to capture the wide-ranging effects on bacterial metabolism:

  • Sample preparation:

    • Careful quenching of metabolism using cold methanol or rapid filtration

    • Extraction methods optimized for different metabolite classes

    • Internal standards for normalization

  • Analytical approaches:

    • Targeted LC-MS/MS for specific metabolite quantification, particularly ubiquinone and intermediates

    • Untargeted metabolomics using high-resolution mass spectrometry

    • NMR spectroscopy for complementary metabolite identification

  • Data analysis workflow:

    • Multivariate statistical approaches (PCA, PLS-DA)

    • Pathway enrichment analysis

    • Integration with transcriptomic and proteomic data

  • Specific analyses for ubiquinone pathway:

    • Quantification of ubiquinone and biosynthetic intermediates

    • Isotope labeling experiments to track metabolic flux

    • Comparative analysis under varying oxygen conditions

This metabolomic profiling should be conducted under different growth conditions, particularly varying oxygen levels, to fully understand how UbiB contributes to metabolic adaptation in V. cholerae.

What genetic engineering approaches can be used to study UbiB function in V. cholerae?

Several genetic engineering approaches are particularly valuable for studying UbiB function:

  • Clean deletion mutants:

    • Allelic exchange methods to create marker-free deletions

    • Complementation with wild-type and mutant variants

    • Conditional depletion systems for essential genes

  • Domain-specific mutations:

    • Site-directed mutagenesis of conserved catalytic residues

    • Domain swapping with homologs from other species

    • Construction of chimeric proteins

  • Reporter fusions:

    • Transcriptional fusions to monitor expression

    • Translational fusions to track localization

    • FRET-based constructs to study protein-protein interactions

  • Advanced genome editing:

    • CRISPR-Cas9 systems adapted for V. cholerae

    • Recombineering approaches for precise genomic modifications

    • Multiplex genome engineering for pathway optimization

When implementing these approaches, researchers should consider:

  • Potential polar effects on downstream genes

  • Appropriate controls for complementation studies

  • Validation of mutant phenotypes through multiple approaches

  • Careful design of genetic constructs to maintain native regulation

How can UbiB research contribute to our understanding of V. cholerae adaptation to environmental stresses?

Research on UbiB and ubiquinone biosynthesis provides valuable insights into how V. cholerae adapts to environmental stresses:

  • Oxygen adaptation: The dual pathways for ubiquinone biosynthesis (O₂-dependent and O₂-independent) represent a sophisticated adaptation enabling V. cholerae to thrive across environments with varying oxygen availability . This metabolic flexibility likely contributes to V. cholerae's success in diverse ecological niches and during host colonization.

  • Energy homeostasis: Maintaining ubiquinone production under stress conditions is critical for cellular bioenergetics and ATP generation. Understanding how UbiB contributes to this process can reveal mechanisms of energy homeostasis during environmental transitions.

  • Integration with stress responses: Coexpression network analysis approaches similar to those described in the search results can reveal how ubiB expression integrates with broader stress response networks in V. cholerae . This systems-level understanding can identify regulatory connections that coordinate metabolic adaptation with stress responses.

  • Biofilm regulation: The connection between energy metabolism and biofilm formation in V. cholerae represents an important area for investigation. Biofilms provide protection against environmental stressors , and the energy requirements for biofilm formation and maintenance may involve UbiB-dependent processes.

Research in this area should aim to integrate multiple data types (transcriptomics, proteomics, metabolomics) to develop a comprehensive model of how UbiB contributes to stress adaptation networks in V. cholerae.

What potential exists for targeting UbiB as an antimicrobial strategy against V. cholerae?

UbiB represents a potential antimicrobial target due to its essential role in ubiquinone biosynthesis and bacterial energy metabolism:

  • Target validation considerations:

    • Essentiality assessment through conditional mutants

    • Phenotypic consequences of UbiB inhibition

    • Specificity relative to human homologs

    • Impact on bacterial fitness and virulence

  • Inhibitor development strategies:

    • Structure-based design if crystal structures become available

    • High-throughput screening approaches

    • Fragment-based drug discovery

    • Repurposing of ATPase inhibitors

  • Potential advantages as a target:

    • Essential for energy metabolism

    • Bacterial-specific features compared to eukaryotic homologs

    • Potential to impair adaptation to host environments

    • May affect both growth and virulence

  • Combination approaches:

    • Synergy with existing antibiotics

    • Potential to sensitize bacteria to host immune defenses

    • Combination with biofilm-disrupting agents like RbmB

A promising combinatorial approach might involve targeting both ubiquinone biosynthesis (via UbiB inhibition) and biofilm formation (using agents like RbmB that disrupt the VPS exopolysaccharide) . This dual-targeting strategy could potentially overcome the protective effects of biofilms while simultaneously compromising bacterial energy metabolism.

How do findings about UbiB in V. cholerae compare with other bacterial species?

Comparative analysis of UbiB across bacterial species reveals important evolutionary insights:

  • Conservation and divergence:

    • UbiB is widely conserved among proteobacteria, suggesting fundamental importance

    • The O₂-dependent pathway involving UbiB appears to be complemented by an O₂-independent pathway in many proteobacteria

    • Species-specific adaptations may exist in the regulation and function of these pathways

  • Functional comparison with E. coli:

    • E. coli UbiB has been characterized as having ATPase activity essential for ubiquinone biosynthesis

    • Similar dual pathway systems exist in E. coli, with UbiB functioning in the O₂-dependent pathway and UbiT, UbiU, and UbiV proteins functioning in the O₂-independent pathway

    • The broader conservation of these dual pathways suggests they provide important metabolic flexibility

  • Pathogen-specific considerations:

    • In pathogens like V. cholerae, the role of UbiB may intersect with virulence mechanisms

    • Adaptations to host environments may influence the regulation and importance of UbiB

    • Coexpression network analysis in V. cholerae has demonstrated that genes with similar functions often cluster together , suggesting UbiB may coexpress with other metabolism or virulence genes

This comparative approach provides evolutionary context for UbiB function and may identify pathogen-specific adaptations that could be exploited for targeted antimicrobial development.

What novel technologies could advance our understanding of UbiB structure and function in V. cholerae?

Several emerging technologies hold promise for advancing UbiB research:

  • Structural biology approaches:

    • Cryo-electron microscopy for membrane-associated protein complexes

    • Integrative structural biology combining multiple techniques

    • Hydrogen-deuterium exchange mass spectrometry for protein dynamics

    • AlphaFold2 and other AI-based structure prediction methods

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize UbiB localization

    • Single-molecule tracking to monitor dynamics

    • Correlative light and electron microscopy for contextual localization

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Network analysis similar to the comprehensive coexpression network described for V. cholerae

    • Machine learning for pathway modeling and prediction

  • Genomic approaches:

    • CRISPR interference for precise transcriptional control

    • Multiplexed genome engineering for pathway optimization

    • Deep mutational scanning to map functional residues

These technologies, particularly when combined, could provide unprecedented insights into how UbiB functions within the complex cellular environment of V. cholerae and how it contributes to metabolic adaptation and pathogenesis.

What are the key unresolved questions about UbiB function in V. cholerae ubiquinone biosynthesis?

Despite progress in understanding ubiquinone biosynthesis, several critical questions remain:

  • Biochemical mechanism:

    • What is the exact catalytic mechanism of UbiB's ATPase activity?

    • How does ATP hydrolysis couple to ubiquinone biosynthesis steps?

    • What are the specific substrates and products of UbiB-catalyzed reactions?

  • Regulatory networks:

    • How is ubiB expression regulated in response to oxygen levels?

    • What transcription factors control ubiB expression?

    • How does UbiB activity integrate with broader metabolic networks?

  • Protein interactions:

    • What proteins directly interact with UbiB?

    • How does UbiB coordinate with other ubiquinone biosynthesis enzymes?

    • Does UbiB function within a stable complex or through transient interactions?

  • Pathogenesis connections:

    • How does UbiB function influence V. cholerae virulence?

    • What role does ubiquinone biosynthesis play during infection?

    • Could UbiB inhibition attenuate pathogenesis?

Answering these questions will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and systems biology. The comprehensive coexpression network analysis approach described for V. cholerae provides a valuable framework for contextualizing UbiB within broader cellular networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.