Recombinant Vibrio cholerae serotype O1 Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Biochemical Function and Mechanism

Lgt recognizes the conserved "lipobox" motif (consensus sequence: LVIASTVIGASC(+1)) on prolipoproteins. Key mechanistic features include:

  • Substrate specificity: Binds phosphatidylglycerol via two distinct sites, with residues R143 and R239 coordinating the diacylglyceryl transfer reaction .

  • Membrane topology: Seven transmembrane segments, with catalytic domains facing the periplasm .

  • Essential residues: Y26, N146, and G154 are indispensable for activity; R143, E151, R239, and E243 strongly influence catalytic efficiency .

Recombinant Applications in Biotechnology

The lgt gene has been repurposed for plasmid maintenance without antibiotics:

FeatureE. coli System V. cholerae System
Chromosomal deletionΔlgtΔlgt
Complementation vectorV. cholerae lgt on plasmidE. coli lgt on plasmid
Selection temperature39°C37°C
Protein yield (example)GST: 15 mg/LCTB subunit: 120 mg/L

This system eliminates antibiotic resistance markers, reducing environmental contamination risks while maintaining >95% plasmid stability .

Essentiality in Pathogenesis

  • lgt deletion is lethal in V. cholerae, making it a potential antimicrobial target .

  • Lipoproteins modified by Lgt contribute to:

    • Toxin secretion (e.g., cholera toxin B subunit)

    • Membrane integrity during host invasion

Industrial Protein Production

  • Cholera vaccine development: Δlgt V. cholerae strains produce CTB at 120 mg/L in 3L fermenters .

  • Process advantages:

    • No antibiotic residues in final products

    • Scalable to 500L manufacturing

Evolutionary Conservation

Lgt enzymes share a signature motif across Gram-negative bacteria:

OrganismSequence (Residues 140-150)Catalytic Efficiency (k<sub>cat</sub>/K<sub>M</sub>)
V. cholerae O1R<sup>143</sup>-E<sup>151</sup>4.2 × 10<sup>3</sup> M<sup>-1</sup>s<sup>-1</sup>
E. coli K-12R<sup>143</sup>-E<sup>151</sup>3.8 × 10<sup>3</sup> M<sup>-1</sup>s<sup>-1</sup>

This conservation enables cross-species complementation for recombinant systems .

Future Directions

  • Antibiotic development: Targeting Lgt's PG-binding sites with palmitic acid analogs shows inhibitory potential .

  • Synthetic biology: Engineering temperature-sensitive lgt variants for inducible protein expression .

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.

Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
lgt; VC0395_A0206; VC395_0691; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Target Names
lgt
Target Protein Sequence
MPQGYLQFPNIDPVLFSIGPLAVRWYGLMYLVGFLFAMWLANRRADRAGSGWTREQVSDL LFAGFLGVVIGGRVGYVIFYNFDLFLADPLYLFKVWTGGMSFHGGLLGVITAMFWYARKN QRTFFGVADFVAPLVPFGLGMGRIGNFMNSELWGRVTDVPWAFVFPNGGPLPRHPSQLYE FALEGVVLFFILNWFIGKPRPLGSVSGLFLAGYGTFRFLVEYVREPDAQLGLFGGFISMG QILSLPMVIIGILMMVWSYKRGLYQDRVAAK
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the maturation of lipoproteins.

Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (lgt) and what role does it play in Vibrio cholerae?

Prolipoprotein diacylglyceryl transferase (lgt) is an essential enzyme that catalyzes a critical step in bacterial lipoprotein biosynthesis. In Vibrio cholerae, as in other Gram-negative bacteria, lgt transfers a diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the cysteine residue in the lipobox of prolipoproteins . This post-translational modification is essential for proper membrane anchoring of bacterial lipoproteins, which perform diverse functions including nutrient acquisition, signaling, and maintaining membrane integrity. The gene encoding lgt is absolutely essential for viability in V. cholerae and other Gram-negative bacteria, as mutations in this gene are lethal .

How does the lgt gene differ between Vibrio cholerae and Escherichia coli?

While the lgt genes from V. cholerae and E. coli encode proteins with the same enzymatic function, they exhibit sufficient sequence divergence to allow for complementation strategies in genetic engineering applications. This evolutionary divergence enables functional complementation while preventing homologous recombination between the chromosomal and plasmid-borne copies . Despite these sequence differences, both genes encode essential functions, as demonstrated by the ability of the V. cholerae lgt gene to complement E. coli lgt deletion mutants and vice versa . The functional interchangeability between these genes has been exploited to develop novel selection systems for stable plasmid maintenance in both bacterial species.

How does lgt relate to the pathogenicity of Vibrio cholerae?

While lgt itself is not directly involved in V. cholerae pathogenicity, it plays an indirect role by enabling the proper processing and localization of various lipoproteins that may contribute to bacterial survival in the host. More importantly from a research perspective, the lgt-based selection system has been successfully employed to produce the cholera toxin B subunit (CTB), a critical component of both licensed and developmental oral cholera vaccines . V. cholerae, the agent of epidemic and endemic cholera, colonizes the small bowel and secretes a potent enterotoxin consisting of a single A subunit that stimulates adenylate cyclase activity and five identical B subunits that bind to the ganglioside GM1 receptor of intestinal mucosal cells . The ability to efficiently produce and secrete the assembled pentameric CTB protein using the lgt-based selection system represents a significant advancement in vaccine development efforts.

How is an lgt-based selection system constructed in Vibrio cholerae?

The construction of an lgt-based selection system in V. cholerae involves several critical steps:

  • Initial Complementation: First, a temperature-sensitive plasmid carrying the E. coli lgt gene (pMT-lgtEc(ts)) is introduced into the wild-type V. cholerae strain (e.g., JS1569) .

  • Chromosomal Deletion: The chromosomal lgt gene is then deleted and replaced with a kanamycin resistance marker through allelic exchange, resulting in a strain that relies on the plasmid-borne lgt for survival .

  • Marker Removal: The kanamycin resistance marker is subsequently removed using Cre recombinase-mediated excision, leaving a clean deletion of the chromosomal lgt gene .

  • Introduction of Expression Vector: Finally, a temperature-insensitive expression vector carrying both the complementing E. coli lgt gene and the gene encoding the recombinant protein of interest (e.g., CTB) is introduced, allowing for high-level expression without antibiotic selection .

This methodology results in extremely stable plasmid maintenance without requiring antibiotics, as loss of the plasmid becomes lethal to the bacterium due to the essential nature of the lgt gene .

What are the key experimental parameters for optimizing recombinant protein expression using the lgt-based system in V. cholerae?

Optimizing recombinant protein expression using the lgt-based system requires careful consideration of several parameters:

ParameterOptimization StrategiesImpact on Expression
Promoter selectionUse of tac promoter under LacI controlAllows tight regulation and high-level induction
Induction conditionsIPTG concentration (typically 1 mM)Controls expression levels and timing
Growth temperature30°C for maintenance; 37-39°C for selectionEnsures plasmid stability and optimal growth
Culture mediumRich media (LB) without antibioticsMaximizes biomass and protein yield
Secretion signalsNative signal sequences for secreted proteinsEnhances proper folding and export
Scale-up conditionsFermentation parameters (pH, aeration, etc.)Maintains productivity at larger scales

Research has demonstrated that the lgt-based system allows for efficient expression of diverse proteins, including both soluble proteins and those forming inclusion bodies, with yields comparable to conventional antibiotic-based selection systems . For secreted proteins like CTB, the system has been successfully scaled from laboratory cultures to 3-liter fermenters with potential for further industrial-scale production .

How can researchers troubleshoot problems with lgt gene complementation in recombinant systems?

Troubleshooting lgt complementation issues requires a systematic approach:

  • Verify Deletion Construction: Confirm the proper deletion of the chromosomal lgt gene by PCR using primers flanking the deletion site (e.g., ECD1 and ECD4 for E. coli constructs) followed by DNA sequencing .

  • Confirm Complementing Gene Presence: Verify the presence of the complementing lgt gene on the plasmid using gene-specific primers (e.g., lgtVC f and lgtVC r for V. cholerae lgt) .

  • Check for Recombination Events: Screen for unintended recombination between chromosomal and plasmid sequences, especially if there is significant sequence similarity.

  • Assess Protein Expression Levels: If the complementing lgt is poorly expressed, consider codon optimization or stronger promoters to ensure sufficient enzyme activity.

  • Monitor Temperature Sensitivity: For systems using temperature-sensitive plasmids, confirm proper growth restriction at non-permissive temperatures.

  • Test Alternative Complementing Genes: If one species' lgt gene fails to complement, try orthologs from related bacterial species with greater sequence divergence.

Successful complementation is indicated by growth of transformants at non-permissive temperatures and confirmed by molecular characterization of the resulting strains .

How can the lgt-based selection system be adapted for different recombinant protein expression needs?

The lgt-based selection system offers remarkable flexibility for diverse protein expression needs through several adaptable features:

  • Promoter Modifications: While the system has been demonstrated using the IPTG-inducible tac promoter, it can be readily adapted to incorporate alternative promoters better suited to specific expression goals . This allows for constitutive expression, auto-induction, or response to different inducers.

  • Secretion Pathways: For proteins requiring secretion, the system can incorporate various signal sequences. This has been successfully demonstrated with CTB, which properly folds, assembles into pentamers, and remains functionally active with GM1 receptor binding capability when secreted .

  • Protein Tags and Fusions: The expression vectors can be modified to include purification tags or fusion partners, as demonstrated with both GST-tagged proteins and the CTB::p45 fusion protein .

  • Host Strain Engineering: Beyond the basic lgt deletion, the host strain can be further engineered to incorporate additional features such as reduced protease activity or enhanced chaperone expression.

  • Cross-Species Application: The fundamental strategy can be applied across various Gram-negative bacterial species, as the lgt gene is essential in these organisms. This has been specifically demonstrated in both E. coli and V. cholerae .

This adaptability makes the system suitable for expressing diverse proteins, from soluble enzymes to complex multimeric structures requiring post-translational modifications.

What are the comparative advantages of using V. cholerae versus E. coli as expression hosts for the lgt-based system?

Choosing between V. cholerae and E. coli as expression hosts involves considering several factors:

FeatureV. choleraeE. coliResearch Implications
Secretion capacitySuperior for certain proteins (e.g., CTB)Limited for some proteinsBetter yields for secreted proteins in V. cholerae
Growth characteristicsSlower growth, specialized media requirementsRapid growth, simple mediaE. coli may offer faster turnaround times
Post-translational modificationsDifferent modification patternsWell-characterizedConsider protein folding requirements
Codon usageDifferent from E. coliStandard for many expression systemsMay require codon optimization for heterologous genes
ScalabilityDemonstrated up to 3L, potentially higherWidely used at industrial scaleBoth systems appear scalable
Genetic toolsFewer available toolsExtensive genetic toolkitE. coli offers more manipulation options

V. cholerae offers particular advantages for proteins that are naturally produced by this organism, such as CTB. The V. cholerae system has successfully produced functional CTB that assembles into pentamers and maintains GM1 receptor binding activity . For researchers focused on cholera vaccine development or related areas, the V. cholerae host provides a more native expression environment.

How does the stability of the lgt-based expression system compare with conventional antibiotic selection methods?

The lgt-based selection system exhibits superior stability compared to conventional antibiotic selection methods:

  • Segregational Stability: Plasmids maintained through lgt complementation show extreme stability without selection pressure, as plasmid loss becomes lethal to the cell . In contrast, antibiotic resistance-based systems can show significant plasmid loss in the absence of antibiotics.

  • Long-Term Cultivation: In extended cultivations, the lgt system maintains plasmid retention at nearly 100%, whereas antibiotic selection systems typically show decreasing stability over time due to antibiotic degradation and emergence of resistant, plasmid-free cells .

  • Scale-Up Performance: The stability advantage becomes even more pronounced in scaled-up processes, where antibiotic costs become significant and degradation more problematic. The lgt system has demonstrated consistent performance in fermentation conditions without antibiotics .

  • Environmental Factors: The lgt system maintains stability across a range of environmental conditions, unlike antibiotic selection which can be affected by pH, temperature, and other factors that influence antibiotic activity.

Experimental data confirm that the plasmid stability in lgt-deleted strains is not compromised compared to parental strains, and expression levels of recombinant proteins are fully comparable to those produced by conventional industrial production plasmids .

What molecular mechanisms explain the lethality of lgt mutations in Gram-negative bacteria?

The lethality of lgt mutations in Gram-negative bacteria stems from several interconnected molecular mechanisms:

  • Disruption of Lipoprotein Processing Pathway: Without functional lgt, prolipoproteins cannot undergo the first step of lipid modification, preventing their proper anchoring to the membrane and disrupting the entire lipoprotein processing pathway .

  • Membrane Integrity Compromise: Lipoproteins play critical roles in maintaining the structural integrity of the cell envelope. Their mislocalization leads to membrane destabilization and increased permeability .

  • Essential Function Disruption: Some lipoproteins perform essential functions, including roles in cell division, nutrient acquisition, and protein folding. The loss of these functions through improper processing is likely lethal .

  • Accumulation of Toxic Intermediates: Unprocessed prolipoproteins may accumulate in the periplasm or membrane, potentially forming toxic aggregates or interfering with other membrane proteins.

  • Envelope Stress Responses: The accumulation of mislocalized lipoproteins triggers envelope stress responses that, when chronically activated, can lead to growth arrest and cell death.

The universal lethality of lgt mutations across Gram-negative bacteria, including both E. coli and V. cholerae, underscores the fundamental importance of this enzyme in bacterial physiology and provides the basis for the selection system's effectiveness .

How do researchers accurately verify the successful deletion of the chromosomal lgt gene and proper complementation?

Verification of lgt deletion and complementation requires a multi-faceted approach:

  • PCR Amplification: Using primers that flank the deletion site (e.g., ECD1 and ECD4 for E. coli constructs), researchers can amplify the region and confirm the deletion by the size difference of the PCR product . DNA sequencing of this product provides definitive confirmation.

  • Antibiotic Resistance Profiling: During the construction process, the deletion strains are tested for the expected pattern of antibiotic sensitivities and resistances that reflect the genetic manipulations (e.g., kanamycin resistance during intermediate construction steps, then sensitivity after marker removal) .

  • Temperature Sensitivity Testing: For systems using temperature-sensitive complementation plasmids, strains are tested for growth at permissive temperatures (e.g., 30°C) and growth inhibition at non-permissive temperatures (e.g., 37-39°C) .

  • Complementing Gene Verification: PCR amplification with gene-specific primers (e.g., lgtVC f and lgtVC r for V. cholerae lgt) confirms the presence of the complementing gene on the plasmid .

  • Functional Assays: Ultimate verification comes from demonstrating the expression of functional recombinant proteins, such as enzymatically active GST or properly assembled CTB pentamers with GM1 binding activity .

This comprehensive verification ensures the integrity of the genetic system and provides confidence in the subsequent protein expression results.

What are the potential effects of lgt deletion on bacterial physiology beyond lipoprotein processing?

While the primary effect of lgt deletion is disruption of lipoprotein processing, several secondary effects may impact bacterial physiology:

How might the lgt-based selection system be combined with other genetic tools to enhance recombinant protein production?

The integration of the lgt-based selection system with complementary genetic tools offers several promising avenues for enhancing recombinant protein production:

  • CRISPR-Cas9 Integration: Combining lgt-based selection with CRISPR-Cas9 technology could enable precise genome modifications while maintaining stable plasmid expression, potentially allowing for streamlined strain optimization.

  • Synthetic Biology Approaches: Incorporation of synthetic regulatory elements, such as orthogonal RNA polymerases or riboswitches, could provide fine-tuned control over expression while maintaining the stability benefits of lgt-based selection.

  • Secretion Pathway Engineering: For secreted proteins like CTB, engineering of the Sec or Tat secretion pathways in conjunction with the lgt system could enhance export efficiency and further improve yields.

  • Metabolic Engineering: Integration with metabolic engineering approaches could optimize precursor supply and energy metabolism to support high-level protein production within the lgt-complemented strain background.

  • Alternative Promoter Systems: Development of promoter systems that function independently of the lac repressor system would be valuable, as the search results indicate that V. cholerae strain JS1569 has mutations that make lac-derived expression systems impossible .

These integrated approaches could address current limitations while maintaining the core advantage of antibiotic-free, stable plasmid maintenance provided by the lgt system.

What are the potential applications of the lgt system beyond recombinant protein production?

The lgt-based selection system has potential applications extending beyond protein production:

  • DNA Vaccine Delivery: The system could be adapted for stable maintenance of DNA vaccine constructs in attenuated V. cholerae strains, potentially enhancing the efficacy of live bacterial vaccines.

  • Metabolic Engineering: For metabolic engineering applications requiring stable maintenance of large biosynthetic pathways, the lgt system could provide superior stability compared to antibiotic selection.

  • Environmental Bioremediation: Engineered bacteria for environmental applications require stable plasmid maintenance without antibiotic selection, making the lgt system potentially valuable for developing strains for bioremediation.

  • Synthetic Biology Circuits: Complex genetic circuits requiring multiple stable plasmids could benefit from the lgt system, potentially in combination with other essential gene complementation strategies.

  • Host-Microbe Interaction Studies: The system could facilitate studies of host-microbe interactions by allowing stable plasmid maintenance in bacteria studying colonization or immune responses without antibiotic interference.

The essential nature of the lgt gene in all Gram-negative bacteria suggests that this strategy could be widely applicable across different bacterial species used in research and biotechnology .

How does the lgt system contribute to addressing concerns about antibiotic resistance gene spread in biotechnology?

The lgt-based selection system offers significant advantages in addressing antibiotic resistance concerns:

  • Elimination of Antibiotic Selection: By eliminating the need for antibiotics in both laboratory and industrial-scale protein production, the system reduces the release of antibiotics into the environment .

  • Removal of Resistance Genes: Expression plasmids in this system do not carry antibiotic resistance genes, preventing their potential horizontal transfer to environmental or pathogenic bacteria .

  • Product Safety: For pharmaceutical applications, the antibiotic-free production system eliminates concerns about antibiotic residues in the final products, potentially simplifying regulatory approval processes .

  • Environmental Release Risk Reduction: In applications where engineered bacteria might be released or accidentally escape into the environment, the absence of antibiotic resistance genes reduces the risk of contributing to the environmental resistome.

  • Containment Strategy: The system provides an effective biological containment strategy, as the engineered strains cannot survive without the complementing plasmid, reducing risks associated with accidental release.

These advantages align with growing regulatory and public concerns about antibiotic resistance, positioning the lgt system as an environmentally responsible alternative to conventional selection methods in biotechnology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.