Recombinant Vibrio cholerae serotype O1 Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Vibrio cholerae Serotype O1 Protease HtpX (htpX)

Recombinant Vibrio cholerae serotype O1 Protease HtpX (htpX) is a bioengineered version of the native protease produced by V. cholerae O1, a pathogen responsible for cholera. This enzyme is expressed in heterologous systems (e.g., Escherichia coli) with a His-tag for purification and structural studies. Native HtpX (also referred to as HA/protease or HapA) is a zinc-dependent metalloprotease belonging to the M4 peptidase family, critical for processing virulence factors like cholera toxin (CT) and toxin-coregulated pilus (TCP) components .

Molecular Structure and Functional Domains

The recombinant HtpX protein spans 287 amino acids (1-287aa) and retains the catalytic core of the native enzyme. Key structural features include:

Domain/FeatureFunctionCitation
Zinc-binding active siteCoordinates Zn²⁺ for catalytic activity
His-tag (N-terminal)Facilitates affinity chromatography
Protease domain (M4 family)Cleaves CT A subunit and other substrates

HtpX exhibits sequence homology to Pseudomonas aeruginosa elastase (LasB) and Bacillus thermoproteolyticus thermolysin, underscoring conserved proteolytic mechanisms .

Native Biological Roles and Regulation

In V. cholerae, HtpX (hapA-encoded) is tightly regulated by quorum sensing and environmental cues:

  1. Quorum Sensing: Activated by HapR and RpoS (σᴴ) under high cell density (>2 × 10⁸ cells/mL) .

  2. Nutrient Limitation: CRP integrates cAMP signals to enhance hapA transcription .

  3. Inversely Regulated with CT/TCP: HtpX expression suppresses ctxAB (CT genes) and tcpA (pilus genes) via CRP-HapR signaling .

HtpX processes CT by nicking the A subunit at T193/I194, enhancing toxin activation during infection .

Recombinant Production and Applications

Recombinant HtpX is produced in E. coli with a His-tag for ease of purification. Key applications include:

ApplicationDetailsCitation
Structural StudiesX-ray crystallography to map active site
Toxin Activation AssaysIn vitro processing of CT A subunit
Drug Target EvaluationTesting inhibitors of protease activity

Mechanistic Studies

  • CT Processing: HtpX cleaves CT A subunit at T193/I194, a site also targeted by host proteases .

  • Regulation: CRP and HapR inversely regulate HtpX and CT/TCP, balancing bacterial persistence and virulence .

Limitations

  • Host Mimicry: Recombinant HtpX lacks post-translational modifications (e.g., glycosylation) present in native V. cholerae .

  • Substrate Specificity: Limited data on non-CT substrates (e.g., RTX toxins or Zonula occludens toxin) .

Comparative Analysis: Native vs. Recombinant HtpX

ParameterNative HtpXRecombinant HtpX
SourceV. cholerae O1 serotypeE. coli expression system
Post-Translational ModsAutocatalytic propeptide processingLacks native maturation pathways
ActivityProcess CT and virulence factors in vivoRetains catalytic activity in vitro

Future Directions

  1. Therapeutic Targeting: Inhibitors of HtpX could disrupt CT activation, reducing disease severity .

  2. Evolutionary Studies: Investigating HtpX homologs in non-O1/O139 strains for pathogenic potential .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life of the product is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
htpX; VC0395_A0635; VC395_1132; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Target Names
htpX
Target Protein Sequence
MKRILLFLATNLAVVLVLSVVLNIVYAVTGMQPGSLSGLLVMAAVFGFGGAFISLLMSKS MALRSVGGVVIDTPRNEMEHWLLETVRRQANQAGIGMPTVAIYDAPDMNAFATGAKRDDS LVAVSTGLLHNMTRDEAEAVLAHEVSHIANGDMVTMTLMQGVVNTFVIFLSRFIANIVAS RDSEEGEGSNMMVYFGVSMVLELVFGFLASFITMWYSRHREFHADAGAAQLVGKHKMIAA LERLKMGQESHLEGSMMAFGITGKRSLSELMMTHPPLEKRIAALRNM
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of proteases in Vibrio cholerae virulence?

Proteases in V. cholerae, including HtpX and the well-characterized hemagglutinin/protease (HA/protease), perform multiple functions in bacterial pathogenesis. HA/protease exhibits a broad range of potentially pathogenic activities, including covalent modification of other toxins, degradation of the protective mucus barrier, and disruption of intestinal tight junctions . Proteases like LapX and Lap are also crucial for aggregation behavior that provides protection from harsh environments and threats to survival . In physiological contexts, these proteases can enhance cholera pathogenesis by increasing the activity of toxic factors, providing access to the microvilli underlying the protective mucus barrier, and facilitating dissemination of the bacteria along the gastrointestinal tract .

How is protease expression regulated in Vibrio cholerae?

Protease expression in V. cholerae is regulated through complex pathways involving quorum sensing, growth phase dependency, and environmental signals. For HA/protease (encoded by hapA), transcription is activated in deceleration and stationary growth phases . The quorum sensing regulator HapR is essential for hapA transcription . Additionally, the rpoS-encoded sigma(s) factor and the cyclic AMP (cAMP) receptor protein (CRP) strongly enhance hapA transcription . Conditions of nutrient limitation result in elevated intracellular cAMP pools and activation of RpoS and CRP, which then activate HapR expression to integrate nutritional and population cell density signals . In research models, V. cholerae enters quorum sensing mode and expresses hapA at cell densities higher than 2 × 10^8 cells/mL .

What are the optimal conditions for expressing recombinant V. cholerae proteases in laboratory settings?

For optimal expression of recombinant V. cholerae proteases, researchers should consider growth phase and population density parameters. Based on the natural regulation patterns, maximal expression occurs in cultures entering stationary phase at high cell density . For laboratory studies of HA/protease, expression is typically achieved at cell densities higher than 2 × 10^8 cells/mL in rich media . When designing experiments to study protease function, it's important to note that the expression of proteases like HapA is repressed by glucose addition in deceleration and stationary phases . The expression system should also account for the native secretion pathway, as proteases like HA/protease are secreted through the Eps (extracellular protein secretion) pathway, which co-localizes with the flagellum at the old pole of the cell .

How can the enzymatic activity of V. cholerae proteases be measured in vitro?

Various methodologies can be employed to measure protease activity. For serine proteases like LapX, catalytic efficiency can be determined using peptide substrates with specific cleavage preferences. LapX, for example, has a preference for cleavage after glutamate and glutamine residues in the P1 position, and processes a physiologically based peptide substrate with a catalytic efficiency of 180 ± 80 M^-1s^-1 . For aminopeptidases like Lap, activity can be measured using leucine p-nitroanilide, with observed catalytic efficiencies of 5.4 ± 4.1 × 10^4 M^-1s^-1 for the full-length enzyme and 20.3 ± 4.3 × 10^4 M^-1s^-1 for the enzyme lacking the inhibitory bacterial prepeptidase C-terminal domain . Multiplex substrate profiling by mass spectrometry is another valuable approach for identifying substrate preferences that could inform in vivo function .

What purification strategies are most effective for obtaining active recombinant V. cholerae proteases?

The purification strategy for V. cholerae proteases must account for their specific characteristics. For metalloproteases like HA/protease, which is Zn-dependent, the purification buffer should contain appropriate metal ions to maintain activity . Consideration should also be given to the natural processing of these proteases. HA/protease, for instance, undergoes removal of the propeptide and C-terminal processing in the extracellular medium through an autocatalytic mechanism . Therefore, recombinant expression systems should be designed to accommodate this processing for optimal activity. For proteases with inhibitory domains, such as Lap with its bacterial prepeptidase C-terminal domain, experimental designs may benefit from generating constructs that eliminate these domains to increase catalytic efficiency, as demonstrated by the four-fold increase observed when this domain is removed .

What are the implications of the Cpx stress response on protease expression and function?

The Cpx stress response pathway significantly impacts protease expression and function in V. cholerae. Activation of the Cpx pathway leads to alterations in the expression of virulence factors, including proteases. The Cpx regulon of V. cholerae is enriched for genes encoding membrane-localized and transport proteins, as well as a large number of iron-regulated genes . Interestingly, the Cpx response positively regulates the toxRS operon but ultimately down-regulates the expression of CT and TCP . This regulation occurs through repression of ToxT and TcpP regulators, and involves interactions with the cyclic adenosine monophosphate (cAMP) receptor protein (CRP) . For researchers studying proteases like HtpX, which may be involved in membrane protein quality control, understanding these stress response pathways is crucial as they may directly or indirectly regulate protease expression and function in response to environmental stressors.

How do proteases contribute to bacterial adaptation to different environmental niches?

Proteases play critical roles in bacterial adaptation to varying environmental conditions. In V. cholerae, the Cpx response mediates adaptation to envelope perturbations caused by toxic compounds and iron depletion, and this pathway influences protease expression . Specifically, proteases like LapX and Lap are essential for aggregation behavior, which provides protection from harsh environments . HA/protease, with its mucinase activity, aids in degrading the protective mucus barrier, facilitating colonization of the intestinal epithelium . The coordinated regulation of these proteases with other factors, such as the inverse regulation of HA/protease and CT, suggests a programmed sequence of events during infection where initial colonization and toxin production are followed by protease expression that facilitates spread and eventual exit from the host .

What explains the apparent contradictions in protease functionality in different experimental models?

Contradictions in protease functionality across experimental models often stem from differences in environmental contexts and regulatory networks. For instance, while HA/protease can activate CT by nicking its A subunit, CT expression is inversely regulated with HA/protease expression . This apparent contradiction is resolved by understanding the temporal dynamics of infection: CT is expressed earlier at low cell density, while HA/protease is expressed later at high cell density, suggesting that HA/protease may activate residual, unnicked CT molecules late in infection . Similarly, HA/protease degrades rather than activates the HlyA toxin, highlighting how the same protease can have opposing effects on different toxins . These observations underscore the importance of considering the experimental conditions, particularly cell density and growth phase, when interpreting protease function data.

How does the catalytic efficiency data of V. cholerae proteases compare with similar enzymes in other pathogens?

Table 1: Comparative Catalytic Efficiencies of Selected Bacterial Proteases

ProteaseOrganismSubstrateCatalytic Efficiency (M^-1s^-1)Reference
LapXV. choleraePeptide substrate180 ± 80
LapXV. choleraeMSP substrate590 ± 20
Lap (full-length)V. choleraeLeucine p-nitroanilide5.4 ± 4.1 × 10^4
Lap (without C-terminal domain)V. choleraeLeucine p-nitroanilide20.3 ± 4.3 × 10^4
Lap (processed by LapX)V. choleraeLeucine p-nitroanilide95.7 ± 5.6 × 10^4
Lap (without C-terminal domain, processed by LapX)V. choleraeLeucine p-nitroanilide11.3 ± 1.9 × 10^5

The data reveals significant variability in catalytic efficiency depending on substrate specificity and protease processing state. The processing of Lap by LapX dramatically increases its catalytic efficiency, demonstrating an important mechanism for amplifying protease activity in vivo . This sequential activation mechanism may be a common theme in bacterial protease networks that requires further comparative analysis across pathogens.

What are the implications of substrate specificity data for developing targeted research tools?

Substrate specificity data provides crucial insights for developing research tools and potential therapeutic interventions. LapX, for example, has a preference for cleavage after glutamate and glutamine residues in the P1 position . This specific cleavage preference can be exploited to design selective inhibitors or activity-based probes for studying LapX function in complex biological systems. For Lap, understanding its aminopeptidase activity and how it's enhanced by LapX processing offers opportunities to develop tools that can distinguish between the unprocessed and processed forms of the enzyme . Such tools would be valuable for dissecting the temporal dynamics of protease activation during bacterial infections or aggregation processes.

What are the potential roles of proteases like HtpX in antibiotic resistance mechanisms?

While direct data on HtpX's role in antibiotic resistance is not provided in the search results, the involvement of the Cpx stress response pathway in adapting to envelope perturbations suggests potential connections. The Cpx pathway activates TolC expression and components of resistance-nodulation-division (RND) efflux systems in V. cholerae . These systems are known to contribute to antibiotic resistance. Given that proteases like HtpX may be involved in membrane protein quality control, future research could explore how HtpX might contribute to maintaining the integrity of these efflux systems under antibiotic stress. Furthermore, the observation that the Cpx pathway is activated by toxic compounds and that mutations eliminating the Cpx response result in growth phenotypes in the presence of these inducers suggests that HtpX and other proteases in this pathway could be potential targets for developing adjuvants to enhance antibiotic efficacy.

How might high-throughput approaches advance our understanding of protease networks in V. cholerae?

High-throughput approaches, such as multiplex substrate profiling by mass spectrometry (MSP-MS) which was used to screen for LapX substrates , offer powerful tools for comprehensively mapping protease substrate preferences and identifying physiological targets. Future research could employ similar techniques to characterize the substrate profiles of other V. cholerae proteases, including HtpX. Proteomics approaches could identify proteins that are differentially processed in wild-type versus protease-deficient strains. Genetic screens, such as transposon insertion sequencing (Tn-seq), could identify genetic interactions that reveal functional connections between different proteases and other cellular pathways. These approaches would be particularly valuable for understanding complex phenotypes like bacterial aggregation, where LapX and Lap act sequentially to regulate timing .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.