Recombinant Vibrio cholerae serotype O1 Protein HflK (hflK)

Shipped with Ice Packs
In Stock

Description

Introduction

Vibrio cholerae is a Gram-negative bacterium that causes cholera, a severe diarrheal disease . V. cholerae O1 serogroup strains are further divided into Ogawa, Hikojima, and Inaba serotypes . The hflK gene encodes the HflK protein, a component that has been studied in the context of bacterial pathogenesis and Type VI secretion systems . Recombinant HflK protein is produced in a laboratory setting using genetic engineering techniques, often in E. coli, to facilitate research on its structure, function, and interactions .

Characteristics of Recombinant Vibrio cholerae serotype O1 Protein HflK (hflK)

Recombinant Vibrio cholerae serotype O1 Protein HflK (hflK) is a full-length protein (1-395 amino acids) with a His-tag, expressed in E. coli .

Table 1: Characteristics of Recombinant HflK Protein

CharacteristicDescription
SourceE. coli
TagHis-tag (N-terminal)
Protein LengthFull Length (1-395 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
AA SequenceMAWNEPGNNNGNNGRDNDPWGNNNRGNKGGRDQGPPDLDEVFNKLSQKLGGKFGGKGGKGPSFSGGGAIGFGVIAAIAVAVWFFTGFYTIGEAERGVVLRLGKYDRIVDPGLNWRPRFIDEVTPVNVQAIRSLRASGLMLTKDENVVTVSMDVQYRIADPYKYLYRVTNADDSLRQATDSALRAVVGDSLMDSILTSGRQQIRQSTQQTLNQVIDSYDMGLMIVDVNFQSARPPEQVKDAFDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNERTINEALGQVAQFEKLLPEYQAAPKVTRDRLYLDAMEQVYSNTSKVLIDSESSGNLLYLPIDKLAGQDNKTAQPRPNKSSSAYDQIELESQTTETNTDTQSRSTTRQGRY
Gene NamehflK
SynonymshflK; VC_0349; Protein HflK
UniProt IDQ9KV09
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃.

Function and Significance

HflK is involved in the Type VI secretion system (T6SS) in V. cholerae . The T6SS is a protein secretion system crucial for Gram-negative bacteria, facilitating interactions between bacteria and their environment . Specifically, HflK, along with other proteins, forms part of the membrane complex required for the assembly and function of the T6SS apparatus.

HflK in V. cholerae O1 Strains

V. cholerae O1 strains can express Hcp, a T6SS component, with expression being growth phase dependent . The expression of Hcp is regulated by quorum sensing regulators HapR and LuxO, as well as the cAMP-CRP global transcriptional regulatory complex, and requires the RpoN sigma factor .

Role in Pathogenicity and Antibiotic Resistance

Non-O1/O139 V. cholerae strains possess genes related to pathogen-host interaction, including T3SS, virulence regulatory factors, transcriptional regulators, and two-component response regulator-related genes . Understanding the molecular mechanisms of pathogenicity and antibiotic resistance in non-O1/O139 V. cholerae strains is vital for developing effective prevention and treatment strategies .

Applications in Research

Recombinant HflK protein is utilized in various research applications:

  • Structural Studies: To determine the three-dimensional structure of the protein, providing insights into its function .

  • Interaction Studies: To identify binding partners and understand its role within the T6SS complex .

  • Vaccine Development: As a potential target for vaccine development, contributing to the creation of new strategies to combat V. cholerae infections .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline for your use.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
hflK; VC_0349; Protein HflK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-395
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Target Names
hflK
Target Protein Sequence
MAWNEPGNNNGNNGRDNDPWGNNNRGNKGGRDQGPPDLDEVFNKLSQKLGGKFGGKGGKG PSFSGGGAIGFGVIAAIAVAVWFFTGFYTIGEAERGVVLRLGKYDRIVDPGLNWRPRFID EVTPVNVQAIRSLRASGLMLTKDENVVTVSMDVQYRIADPYKYLYRVTNADDSLRQATDS ALRAVVGDSLMDSILTSGRQQIRQSTQQTLNQVIDSYDMGLMIVDVNFQSARPPEQVKDA FDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNERTINEALGQVAQFEK LLPEYQAAPKVTRDRLYLDAMEQVYSNTSKVLIDSESSGNLLYLPIDKLAGQDNKTAQPR PNKSSSAYDQIELESQTTETNTDTQSRSTTRQGRY
Uniprot No.

Target Background

Function
HflC and HflK may encode or regulate a protease.
Database Links

KEGG: vch:VC0349

STRING: 243277.VC0349

Protein Families
Band 7/mec-2 family, HflK subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How does HflK differ from other regulatory proteins in Vibrio cholerae?

Unlike global regulators such as H-NS that directly affect transcription of virulence genes like rfbT , or Hfq which modulates gene expression post-transcriptionally through RNA binding , HflK likely functions at the protein level. While Hfq is essential for Vibrio cholerae virulence and suckling mouse intestine colonization , and proteins like LPLUNC1 modulate innate immune responses , the specific regulatory role of HflK in Vibrio cholerae pathogenesis requires further investigation.

What expression systems are recommended for recombinant HflK production?

The most established system for recombinant HflK production is E. coli expression with an N-terminal His-tag. This approach has been successfully used to produce the full-length protein (amino acids 1-395) with proper folding and functionality . When designing expression constructs, researchers should consider:

Expression ParameterRecommended ConditionRationale
Host strainE. coli BL21(DE3) or similarReduced protease activity, high expression
VectorpET series with T7 promoterTight control of expression
Fusion tagN-terminal His-tagFacilitates purification while maintaining function
Induction0.5-1.0 mM IPTGBalance between yield and solubility
Growth temperature16-25°C post-inductionReduces inclusion body formation

What are the optimal conditions for reconstitution of lyophilized recombinant HflK?

For optimal reconstitution of lyophilized HflK protein, follow these methodological steps:

  • Briefly centrifuge the vial containing lyophilized HflK protein to bring contents to the bottom.

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (with 50% being optimal for long-term storage).

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles.

  • Store aliquots at -20°C/-80°C for long-term storage .

Avoid repeated freeze-thaw cycles as they significantly reduce protein activity. Working aliquots may be stored at 4°C for up to one week .

What is the predicted membrane topology of HflK and how does it affect experimental design?

Based on sequence analysis and structural predictions, HflK contains transmembrane domains that anchor it to the bacterial membrane. The presence of these hydrophobic regions requires careful consideration in experimental design:

  • For structural studies, detergent screening is necessary to identify optimal solubilization conditions.

  • When designing functional assays, maintaining the native membrane environment or using appropriate membrane mimetics is crucial.

  • If studying interactions with other proteins, consider whether interactions occur in membrane-proximal regions or cytoplasmic domains.

How does HflK potentially interact with virulence regulatory networks in Vibrio cholerae?

While direct evidence linking HflK to specific virulence pathways is limited, several hypothetical mechanisms can be proposed based on knowledge of related systems:

  • HflK may function in quality control of membrane proteins involved in virulence factor secretion or surface presentation.

  • It could potentially interact with regulatory networks controlled by global regulators like H-NS, which is known to repress serotype conversion through rfbT regulation .

  • HflK might indirectly influence virulence by affecting stress responses, similar to how the alternative sigma factor σE controls approximately half the genes upregulated in an hfq mutant .

Experimental approaches to test these hypotheses would include co-immunoprecipitation studies, comparative proteomics of wildtype versus hflK mutants, and virulence assays in animal models.

How can I establish a reliable Vibrio cholerae hflK knockout model for functional studies?

Developing a reliable hflK knockout model requires careful consideration of genetic tools and phenotypic validation:

  • Construction approaches:

    • Allelic exchange using suicide vectors (e.g., pCVD442)

    • CRISPR-Cas9 mediated genome editing

    • Transposon mutagenesis screening

  • Validation methods:

    • PCR verification of the deletion

    • RT-qPCR to confirm absence of transcript

    • Western blotting to verify protein absence

    • Complementation studies to confirm phenotype specificity

  • Phenotypic characterization:

    • Growth curves under various stress conditions

    • Membrane integrity assays

    • Virulence factor expression analysis

    • Animal colonization models

When analyzing phenotypes, compare results to other regulatory mutants (e.g., hns or hfq) to contextualize the role of HflK within Vibrio cholerae virulence networks .

How might HflK contribute to serotype switching mechanisms in Vibrio cholerae?

Serotype switching between Ogawa and Inaba in Vibrio cholerae involves the rfbT gene, which encodes a methyltransferase responsible for O-antigen methylation . While current research shows H-NS directly represses rfbT transcription, the potential role of HflK in serotype switching requires investigation through:

  • Comparative analysis of rfbT expression and methyltransferase activity in wildtype vs. hflK mutant strains

  • Assessment of O-antigen structure in hflK mutants using mass spectrometry

  • Epistasis studies combining hflK mutations with other regulatory mutations (e.g., hns)

  • Analysis of HflK expression during environmental transitions that might trigger serotype switching

This research direction could reveal whether HflK functions in post-translational regulation of RfbT or other components of the O-antigen biosynthesis pathway.

What is the significance of HflK in the context of Vibrio cholerae stress response networks?

Given that other regulatory proteins like Hfq influence alternative sigma factors such as σE , investigating HflK's potential role in stress response networks could provide valuable insights:

  • Transcriptomic approach: Compare gene expression profiles between wildtype and hflK mutant strains under various stress conditions (oxidative stress, acid stress, bile exposure)

  • Proteomic analysis: Identify proteins with altered abundance or post-translational modifications in hflK mutants

  • Epistasis studies: Create double mutants (hflK/σE pathway components) to determine functional relationships

  • In vivo relevance: Assess colonization efficiency and competitive index of hflK mutants in animal models

Understanding HflK's role in stress response networks could reveal novel connections between membrane protein quality control and virulence regulation in Vibrio cholerae.

How can structural analysis of HflK inform the development of novel antimicrobial strategies?

Advanced structural characterization of HflK could potentially identify unique features that might be exploited for antimicrobial development:

  • Cryogenic electron microscopy of the full HflK complex in membrane environments

  • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions

  • Fragment-based screening to identify small molecules that disrupt HflK function

  • In silico docking studies based on resolved structures

If HflK proves essential for Vibrio cholerae virulence or stress adaptation, these structural insights could guide the development of novel antimicrobial approaches targeting protein-protein interactions within the HflK complex.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.