Recombinant Vibrio cholerae serotype O1 Putative zinc metalloprotease VC_2253 (VC_2253)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Vibrio cholerae serotype O1 Putative Zinc Metalloprotease VC_2253 (VC_2253) is a protein expressed by Vibrio cholerae, a bacterium that causes cholera . VC_2253 exhibits significant similarity to YaeL, a zinc metalloprotease involved in bacterial response to extracytoplasmic stress . Metalloproteases are enzymes that require a metal ion, such as zinc, to function and catalyze the hydrolysis of peptide bonds in proteins. They play diverse roles in bacterial physiology and pathogenesis .

Gene Information

The gene encoding VC_2253 is designated as VC_2253 . Synonyms for this gene include VC_2253 and Putative zinc metalloprotease VC_2253 . The UniProt ID for VC_2253 is Q9KPV9 .

Function and Role in Vibrio cholerae

VC_2253 is involved in the degradation of the membrane-localized virulence activator TcpP . TcpP and ToxR are virulence regulators in Vibrio cholerae . A study found that a transposon insertion in VC2253 resulted in elevated toxT-lacZ expression, suggesting that VC2253 normally functions to inhibit virulence gene expression .

Table 1: β-galactosidase activity in V. cholerae strains

StrainActivity, Miller units
O395 toxT-lacZ370 ± 20.3
O395 ΔtcpH toxT-lacZ35.7 ± 9.4
Tn mutant (VC2253::Tn)374 ± 24.8

Role in Zinc Homeostasis

V. cholerae utilizes zinc uptake systems to maintain zinc homeostasis . The bacterium encodes genes under the control of the Zur repressor to cope with zinc starvation stress . VC_2253 does not appear to be directly involved in zinc uptake, but its function as a metalloprotease suggests it requires zinc for its enzymatic activity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag type, please inform us, and we will prioritize its development.
Synonyms
VC_2253; Putative zinc metalloprotease VC_2253
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-452
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Target Names
VC_2253
Target Protein Sequence
MTDILWNFIAFIIALGILVAVHEFGHFWVARRCGVKVEKFSIGFGKSIWKRVGHDGTEYS ISMIPLGGYVKMLDGRVDDVPAEQQAMAFDKQSLWKRSAIVSAGPIFNFLFAIFAYWLVF MIGVPAVKPVIGEVTPYSIAAQAGLEPGMEIKAVSGVNTPDWESVNMGLIGHIGDDSMTI TVSSAEGVGLNEIKTINLRDWNFDPETESAMGALGFKPFTPEISNQLTNVSAQGAGERAG LQVGDTVLQINGQAVEAWQQVVNAIQSHPNAPIAVMVERAGQQVELTLIPDSRELSQGKV IGFAGIAPKVAEWPQNYRFELQFGVFESLGKAVEKSGQVIDLTVSMLKKLLVGDVGLNNL SGPISIAKGAGTTADYGFVYFLGFLALISINLGIINLVPLPMLDGGHLLFFMIEAVIRRP VPEKVQEMGYRIGGAIIFSLMAVAIFNDFTRL
Uniprot No.

Target Background

Database Links

KEGG: vch:VC2253

STRING: 243277.VC2253

Protein Families
Peptidase M50B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What experimental approaches are recommended for studying VC_2253 function?

Based on established methodologies for studying bacterial metalloproteases, researchers investigating VC_2253 should consider a multi-faceted experimental approach:

  • Genetic manipulation studies:

    • Generate VC_2253 knockout mutants using precise gene deletion techniques

    • Create site-directed mutants specifically targeting the zinc-binding motif

    • Develop complementation strains with both wild-type and mutated versions of VC_2253

  • Protein expression and purification:

    • Express recombinant VC_2253 with appropriate tags (e.g., His-tag) for purification

    • Ensure proper folding and activity through careful reconstitution protocols

    • Consider expressing the protein in native V. cholerae to maintain authentic post-translational modifications

  • Enzymatic activity assays:

    • Develop in vitro proteolytic assays using synthetic peptides or protein substrates

    • Test activity under various conditions (pH, temperature, zinc concentration)

    • Use metalloprotease inhibitors to confirm zinc dependence

  • In vivo colonization and virulence studies:

    • Employ animal models (infant mouse, adult mouse) to assess colonization efficiency

    • Use rabbit ileal loop models to evaluate pathogenesis and tissue reactivity

    • Compare wild-type, mutant, and complemented strains to establish causality

Similar approaches have been successfully used to characterize the Mop metalloprotease, revealing that complementation with wild-type protein but not with a protein containing mutations in the zinc metalloprotease motif could restore the normal phenotype .

How do zinc transport systems in V. cholerae potentially influence VC_2253 function?

As a putative zinc metalloprotease, VC_2253 likely requires zinc for its catalytic activity. V. cholerae possesses dual zinc transporter systems that maintain zinc homeostasis, which may indirectly regulate VC_2253 function:

  • Zinc transport systems in V. cholerae:

    • Two primary gene clusters: znuABC (VC2081-VC2083) and zrgABCDE (VC2551-VC2555)

    • Both are regulated by the zinc uptake regulator Zur in a Zn²⁺-dependent manner

    • ZnuABC plays the predominant role in zinc uptake under limiting conditions

    • Both systems contribute to bacterial growth and colonization capacity

  • Potential regulatory mechanisms:

    • Zinc availability may directly affect VC_2253 catalytic activity

    • VC_2253 expression might be co-regulated with zinc transport systems

    • Under zinc-limiting conditions (as in host environments), VC_2253 function could be modulated

  • Experimental approaches to explore this relationship:

    • Analyze VC_2253 expression and activity under varying zinc concentrations

    • Investigate potential Zur regulation of VC_2253 expression

    • Study phenotypes of combined mutants (VC_2253 with znuABC or zrgABCDE)

This relationship is particularly significant as research has shown that zinc transport systems are important for V. cholerae colonization in both infant and adult mouse models, especially in the presence of competing intestinal microbiota .

What methodological approaches can be used to identify potential substrates of VC_2253?

Identifying the physiological substrates of VC_2253 is crucial for understanding its function in V. cholerae biology. Several complementary approaches can be employed:

  • Proteomics-based approaches:

    • Comparative proteomics between wild-type and ΔVC_2253 strains to identify accumulated substrates

    • Terminal Amine Isotopic Labeling of Substrates (TAILS) to directly identify cleaved proteins

    • Protein microarrays to screen for potential substrates in vitro

  • Bioinformatic predictions:

    • Sequence analysis to identify potential cleavage site motifs

    • Structural modeling to predict substrate binding pockets

    • Comparative analysis with characterized bacterial metalloproteases

  • In vitro validation:

    • Recombinant protein cleavage assays with candidate substrates

    • Site-directed mutagenesis of predicted cleavage sites

    • Kinetic analysis to determine substrate preferences

  • In vivo confirmation:

    • Co-immunoprecipitation to detect protein-substrate interactions

    • Fluorescence resonance energy transfer (FRET)-based assays in living bacteria

    • Genetic approaches to confirm functional relationships between VC_2253 and substrates

How might environmental conditions affect VC_2253 expression and activity?

V. cholerae transitions between diverse environments during its lifecycle, which likely influences VC_2253 expression and activity through several mechanisms:

  • Potential environmental regulators:

    • pH variations (marine environment vs. human intestine)

    • Nutrient availability and carbon source differences

    • Osmolarity changes

    • Zinc availability in different niches

    • Host-derived signals during infection

  • Expression regulation:

    • Transcriptional control through environmental sensing systems

    • Potential involvement of the Zur regulator in response to zinc availability

    • Post-transcriptional regulation via small RNAs or riboswitches

  • Activity modulation:

    • Direct effects of pH and ion concentration on enzymatic activity

    • Substrate availability in different environments

    • Protein stability and turnover under various conditions

  • Experimental approaches:

    • Transcriptional reporter fusions to monitor expression under different conditions

    • Protein activity assays across environmental gradients

    • In vivo expression technology (IVET) to assess expression during infection

    • RNA-seq analysis under varied environmental conditions

This environmental responsiveness may be integral to VC_2253's function, potentially allowing V. cholerae to adapt its proteolytic activities to specific niches during colonization and infection.

What are the key considerations for designing knockout and complementation studies of VC_2253?

Genetic manipulation studies are essential for defining VC_2253 function. Researchers should consider the following experimental design elements:

  • Knockout strategy design:

    • Non-polar deletion to avoid affecting adjacent genes

    • Marker-free approaches to eliminate potential phenotypic interference

    • Preservation of native regulatory regions

    • Verification of deletion by both PCR and sequencing

  • Complementation approaches:

    • Expression from native promoter at physiological levels

    • Chromosomal integration vs. plasmid-based complementation

    • Inclusion of site-directed mutants targeting the zinc-binding motif

    • Tagged versions for protein detection and localization studies

  • Control considerations:

    • Empty vector controls for plasmid-based complementation

    • Wild-type strain with the same genetic manipulations (e.g., marker insertions)

    • Complementation with known non-functional versions as negative controls

  • Phenotypic characterization:

    • Growth characteristics under various conditions

    • Stress response profiling

    • Virulence factor production

    • Host colonization efficiency

    • Tissue pathology in animal models

Similar approaches have been successfully employed with the Mop metalloprotease, where complementation with wild-type but not with zinc-binding motif mutants restored normal function in vivo .

What animal models are most appropriate for studying VC_2253's role in pathogenesis?

Based on existing V. cholerae research, several animal models can be employed to investigate VC_2253's role in pathogenesis:

  • Infant mouse colonization model:

    • Advantages: Well-established, quantitative assessment of colonization efficiency

    • Methodology: Oral infection of 5-6 day old mice, recovery of bacteria from intestines

    • Measurements: Competitive index between wild-type and mutant strains

    • Relevance: Demonstrated importance of zinc transport systems in this model

  • Adult mouse model:

    • Advantages: Permits study with mature gut microbiome

    • Methodology: Typically requires antibiotic treatment to permit colonization

    • Applications: Particularly valuable for studying interactions with intestinal microbiota

    • Findings: Zinc transport systems shown to be important in this model

  • Rabbit ileal loop model:

    • Advantages: Permits detailed analysis of pathological changes

    • Methodology: Surgical creation of ligated intestinal loops followed by direct inoculation

    • Measurements: Fluid accumulation, tissue pathology, inflammatory responses

    • Precedent: Successfully used to characterize the Mop zinc metalloprotease

  • Experimental design considerations:

    • Include appropriate controls (wild-type, complemented strains)

    • Perform both single-strain infections and competitive infections

    • Analyze multiple parameters (colonization, fluid accumulation, tissue damage)

    • Consider time-course studies to assess disease progression

The rabbit ileal loop model has proven particularly informative for zinc metalloproteases, revealing significant histopathological changes including "widening of submucosa, with an increase in inflammatory cells, diffuse lymphatic vessel dilatation, edema, endothelial cell hypertrophy of blood vessels, blunting of villi, and lacteal dilatation with lymphocytes and polymorphonuclear leukocytes" .

How should researchers design experiments to distinguish between direct and indirect effects of VC_2253?

Distinguishing direct from indirect effects is a critical challenge when characterizing bacterial virulence factors. For VC_2253 research, consider these experimental approaches:

  • In vitro vs. in vivo studies:

    • In vitro: Direct biochemical assays with purified components

    • In vivo: Systems-level analysis in bacterial cultures and animal models

    • Comparative analysis to identify consistencies and discrepancies

  • Direct effect identification:

    • Demonstrate direct protein-substrate interactions through biochemical methods

    • Confirm specific cleavage events with purified components

    • Utilize catalytic site mutants as negative controls

    • Perform kinetic analyses to establish enzyme-substrate relationships

  • Indirect effect characterization:

    • Transcriptomics/proteomics to identify global changes upon VC_2253 deletion

    • Genetic suppressor screens to identify compensatory pathways

    • Epistasis analysis with related genes to establish pathway relationships

    • Time-course studies to distinguish primary from secondary effects

  • Experimental design elements:

    • Include appropriate controls for each experimental approach

    • Use multiple, complementary methods to address the same question

    • Establish clear criteria for distinguishing direct from indirect effects

    • Consider concentration-dependent effects in dose-response studies

This multi-faceted approach follows established experimental design principles, with careful attention to variables, controls, and methodological considerations .

How should researchers interpret contradictory results when studying VC_2253?

Contradictory results are common in complex biological systems and require systematic analysis:

  • Sources of experimental variability:

    • Strain background differences (clinical isolates vs. laboratory strains)

    • Growth conditions and media composition

    • Experimental model variations (in vitro vs. different animal models)

    • Technical variations in protein preparation and handling

  • Biological explanations for contradictions:

    • Context-dependent function (environmental responsiveness)

    • Redundancy with other metalloproteases

    • Dual functions under different conditions

    • Strain-specific effects

  • Analytical approaches:

    • Standardize experimental conditions across studies

    • Perform meta-analysis of multiple datasets

    • Design experiments specifically to resolve contradictions

    • Consider mathematical modeling to integrate contradictory data

  • Interpretation framework:

    • Evaluate the methodological strengths and limitations of each study

    • Consider biological plausibility of different interpretations

    • Develop testable hypotheses to resolve contradictions

    • Acknowledge complexity rather than forcing simplified narratives

The complexity of metalloprotease function is illustrated by the Mop protein, which modulates pathogenesis rather than simply enhancing or inhibiting it, suggesting that apparent contradictions may reflect nuanced biological roles .

What analytical approaches can help distinguish VC_2253 function from other zinc metalloproteases?

Distinguishing the specific functions of VC_2253 from other metalloproteases requires specialized analytical approaches:

  • Comparative genomics and bioinformatics:

    • Phylogenetic analysis to identify evolutionary relationships

    • Domain architecture comparison across metalloproteases

    • Identification of unique sequence motifs in VC_2253

    • Structural modeling to predict functional differences

  • Biochemical profiling:

    • Substrate specificity analysis using peptide libraries

    • Inhibitor sensitivity profiling

    • Metal ion preference determination

    • Kinetic parameter comparison with other metalloproteases

  • Double knockout studies:

    • Generate single and combination knockouts of multiple metalloproteases

    • Analyze phenotypic differences between single and double mutants

    • Identify synthetic interactions indicating functional relationships

    • Perform complementation with chimeric proteins containing domains from different metalloproteases

  • Localization studies:

    • Determine subcellular localization of different metalloproteases

    • Identify temporal expression patterns during infection

    • Compare tissue distribution in animal models

    • Analyze co-localization with potential substrates

These approaches can help establish the unique functional niche of VC_2253 within the broader context of V. cholerae metalloproteases and zinc homeostasis systems .

How can researchers validate the physiological relevance of in vitro findings for VC_2253?

Bridging the gap between in vitro biochemical data and physiological relevance requires systematic validation:

  • Correlation of in vitro and in vivo phenotypes:

    • Compare enzyme kinetics with infection outcomes

    • Correlate substrate cleavage efficiency with pathological changes

    • Validate that in vitro conditions reflect the in vivo environment

  • Genetic validation approaches:

    • Site-directed mutagenesis of catalytic residues identified in vitro

    • Substrate modification to prevent cleavage in vivo

    • Complementation with varying levels of enzymatic activity

  • Direct detection in biological samples:

    • Antibody-based detection of cleavage products in infected tissues

    • Mass spectrometry identification of processed substrates during infection

    • In situ zymography to visualize protease activity in tissue sections

  • Physiological context experiments:

    • Recreate relevant microenvironmental conditions (pH, ion concentrations)

    • Study activity in the presence of host factors (immune proteins, mucins)

    • Analyze temporal dynamics throughout infection progression

This approach has been demonstrated with other zinc metalloproteases, where mutations in the catalytic motif identified in vitro were shown to affect pathogenesis in animal models, confirming physiological relevance .

How might understanding VC_2253 contribute to novel therapeutic approaches for cholera?

Understanding VC_2253 function could inform new therapeutic strategies through several avenues:

  • Potential as a drug target:

    • Development of specific metalloprotease inhibitors targeting VC_2253

    • Structure-based drug design utilizing the zinc-binding pocket

    • Combination approaches targeting multiple metalloproteases simultaneously

    • Peptidomimetic inhibitors based on substrate cleavage sites

  • Diagnostic applications:

    • Detection of VC_2253 activity as a biomarker for virulent strains

    • Monitoring VC_2253 expression to predict disease severity

    • Development of rapid diagnostic tests based on protease activity

  • Vaccine development considerations:

    • Evaluation of VC_2253 as a potential vaccine antigen

    • Use of inactive VC_2253 mutants in attenuated live vaccines

    • Understanding how VC_2253 might affect host immune responses

  • Broader therapeutic implications:

    • Insights into zinc homeostasis as a general antimicrobial target

    • Understanding metalloprotease regulation across bacterial pathogens

    • Development of targeted approaches to disrupt bacterial adaptation in the host

Research on zinc transport systems has already demonstrated their importance for V. cholerae colonization, suggesting that targeting zinc-dependent processes like VC_2253 function could impair infection .

What emerging technologies could advance VC_2253 research?

Several cutting-edge technologies could significantly advance our understanding of VC_2253:

  • Advanced genetic manipulation techniques:

    • CRISPR-Cas9 genome editing for precise modifications

    • CRISPRi for tunable gene repression

    • Base editing for specific amino acid substitutions

    • Inducible degradation systems for temporal control of protein levels

  • High-resolution structural biology:

    • Cryo-electron microscopy to visualize protein complexes

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Single-molecule FRET to observe protein motions during catalysis

    • Advanced NMR techniques for solution-state structural analysis

  • Systems biology approaches:

    • Single-cell RNA-seq to capture population heterogeneity

    • Proteomics with enhanced coverage of membrane proteins

    • Metabolomics to identify downstream effects of proteolytic activity

    • Multi-omics integration for comprehensive pathway analysis

  • Advanced imaging:

    • Super-resolution microscopy for subcellular localization

    • Intravital microscopy to visualize infection dynamics in real-time

    • Activity-based probes for in situ detection of metalloprotease activity

    • Correlative light and electron microscopy for ultrastructural context

These technologies could help resolve current knowledge gaps regarding VC_2253 function, regulation, and physiological relevance in V. cholerae pathogenesis.

How does VC_2253 research connect to broader questions in bacterial pathogenesis?

VC_2253 research intersects with several fundamental questions in bacterial pathogenesis:

  • Bacterial adaptation mechanisms:

    • How pathogens modulate virulence in response to environmental cues

    • Mechanisms of tissue-specific adaptation during infection

    • Role of metalloproteases in bacterial stress responses

    • Balance between virulence and persistence in host tissues

  • Host-pathogen interactions:

    • How bacterial proteases counteract host defense mechanisms

    • Modification of host signaling pathways through targeted proteolysis

    • Role of zinc sequestration in nutritional immunity

    • Impact of bacterial metalloproteases on tissue barrier integrity

  • Bacterial physiology integration:

    • Coordination between zinc homeostasis and virulence factor expression

    • Metalloprotease involvement in bacterial cell envelope maintenance

    • Connection between proteolytic networks and other cellular processes

    • Role in biofilm formation and bacterial community behavior

  • Evolution of virulence:

    • Origin and diversification of bacterial metalloproteases

    • Selective pressures driving metalloprotease function

    • Horizontal gene transfer and acquisition of proteolytic capabilities

    • Convergent evolution of similar mechanisms across bacterial pathogens

These connections highlight how VC_2253 research contributes to our broader understanding of bacterial pathogenesis mechanisms, with potential implications for multiple infectious diseases beyond cholera.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.