Recombinant Vibrio cholerae serotype O1 Toxin coregulated pilus biosynthesis outer membrane protein C (tcpC)

Shipped with Ice Packs
In Stock

Description

Biological Role in TCP Biogenesis

TcpC is a member of the secretin protein superfamily and forms a complex with TcpQ, a periplasmic protein required for TCP assembly . Key functions include:

  • Outer Membrane Localization: TcpC-TcpQ complexes stabilize TCP machinery in the outer membrane. Deletion of tcpQ abolishes TcpC expression, and vice versa .

  • Secretin Complex Formation: TcpC forms a high-molecular-weight SDS-resistant complex (≥650 kDa), characteristic of secretins .

  • Pilus Retraction: TcpC interacts with the minor pilin TcpB, facilitating TCP elongation/retraction cycles critical for TcpF secretion and bacterial colonization .

Role in V. cholerae Pathogenicity

  • Colonization: TCP mediates bacterial attachment to intestinal epithelial cells. Recombinant TcpC is used to study microcolony formation and matrix interactions observed in V. cholerae-infected intestines .

  • Regulation: TcpC expression is controlled by the ToxR-ToxT virulence regulon, which activates tcp operon transcription under host-inducing conditions .

  • Antigenic Potential: TCP is immunogenic, and TcpC is a candidate for subunit vaccines targeting V. cholerae colonization .

Research Applications

Recombinant TcpC is utilized in:

  • Structural Studies: Elucidating interactions with TcpQ, TcpB, and secreted effectors like TcpF .

  • Functional Assays: Investigating TCP-dependent processes such as autoagglutination, phage CTXΦ transduction, and host cell adhesion .

  • Therapeutic Development: Screening inhibitors targeting secretin complexes to disrupt TCP assembly .

Key Research Findings

  • TcpC-TcpQ Interaction: Direct binding confirmed via His-tag pull-down assays. This complex is essential for outer membrane localization of both proteins .

  • Retraction Mechanism: TcpC stabilizes TcpB domains involved in pilus retraction, which is critical for TcpF secretion and bacterial persistence in the gut .

  • Biotype Variability: El Tor biotype strains with classical tcpC variants exhibit enhanced TCP production and colonization efficiency .

Technical Considerations

  • Reconstitution: Requires sterile water and glycerol (5–50%) for long-term storage .

  • Stability: Sensitive to repeated freeze-thaw cycles; working aliquots stored at 4°C for ≤1 week .

Future Directions

Current research focuses on:

  • Resolving the atomic structure of the TcpC-TcpQ secretin complex.

  • Developing anti-TcpC monoclonal antibodies for diagnostic and therapeutic use.

  • Engineering attenuated V. cholerae strains with tcpC deletions for live vaccine development .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please clearly indicate your desired format when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, kindly consult your local distributor.
Note: All protein shipments default to standard blue ice packs. If you require dry ice shipment, please notify us in advance as an additional fee will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
tcpC; VC_0831; Toxin coregulated pilus biosynthesis outer membrane protein C; TCP pilus biosynthesis protein TcpC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
17-489
Protein Length
Full Length of Mature Protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Target Names
tcpC
Target Protein Sequence
CSNTNLLKDNLASEQSVINLSKSSNEAKSRNIEFLSGAYLSERKVPKHDIKFSGKYVEFE SKSPIELIDVLDGLSKQYNIQYVFSDELEDENSEENKKSSGSSSAKKIKYSGPLAGFFDY LSSAYNMHFEFGHNNLVKAYHYKNQVFNLQQYFDDNKFSSSMQIGGTSGTSSGLKGTADT AIESNSWEKIDEFLSASLGETGKFTIFEDYSLVTVKARPDKFLLLHTFFDKLINESKMQI AVDYRVVSLSEERLNQLAAKFGIENAGKYSITSDMVDAISLSQVGGGLGASYRSASARLD AVVNELSQEVMHEGHFIGIPNRVMPLNVTTNSKYISSIETTKDTNTDEETRTVKVSDLVT GFSMMVMPKILDDGRIQISSGFSRKQLVSIGTAQGITLPTVDENESMNTVTMNPGEVRLA MLFKDNYIQNSNGVQLLGGGTENKKSARYIAVLVGASSYKTNDLASNRVNIYD
Uniprot No.

Target Background

Function
Involved in TCP pilus biogenesis.
Database Links

KEGG: vch:VC0831

STRING: 243277.VC0831

Subcellular Location
Cell membrane; Lipid-anchor.

Q&A

What is the biological role of tcpC in Vibrio cholerae pathogenesis?

TcpC is an essential outer membrane protein involved in the biogenesis of the Toxin-coregulated pilus (TCP) in Vibrio cholerae. Research indicates that tcpC forms part of a TcpC-TcpQ outer membrane complex that plays a crucial role in the assembly and export of pilus subunits . TCP is a critical colonization factor that enables V. cholerae to establish infection in the human small intestine. The absence of functional tcpC severely impairs TCP formation, resulting in reduced colonization capability and attenuated virulence. The protein's position in the outer membrane suggests it functions as a channel or assembly platform for the growing pilus structure.

How does tcpC contribute to the TCP biogenesis pathway?

TcpC functions as a component of the specialized secretion apparatus responsible for TCP biogenesis. Based on structural and functional analyses, tcpC likely forms a β-barrel pore in the outer membrane through which pilus subunits are transported after their synthesis in the cytoplasm and processing in the periplasm. The TcpC-TcpQ complex appears to coordinate with other TCP proteins to facilitate proper folding, assembly, and extension of the pilus filament. This complex represents a specialized variant of secretion systems found in Gram-negative bacteria, tailored specifically for pilus biogenesis.

What regulatory mechanisms control tcpC expression?

The expression of tcpC is regulated as part of the larger tcp operon and is subject to the complex regulatory cascade controlling virulence in V. cholerae. The ToxR/ToxS and TcpP/TcpH membrane protein complexes activate transcription of toxT, and ToxT subsequently activates transcription of the tcp operon genes, including tcpC . This regulation is responsive to environmental conditions, with TCP production being strongly influenced by factors such as temperature, pH, bile salts, and osmolarity. The integrated regulation ensures that tcpC expression is coordinated with other virulence factors, enabling efficient colonization when the bacterium encounters the appropriate host environment.

Regulatory FactorFunctionEffect on tcpC Expression
ToxR/ToxSMembrane-bound transcriptional activator complexActivates toxT transcription, indirectly increasing tcpC expression
TcpP/TcpHMembrane-bound transcriptional activator complexEssential for toxT transcription, indirectly increasing tcpC expression
ToxTAraC-family transcriptional activatorDirectly activates tcp operon transcription, including tcpC
Environmental conditions (temperature, pH)Signal for host environmentModulates activity of regulatory proteins

What genetic tools are most effective for studying tcpC function?

For genetic analysis of tcpC, several complementary approaches have proven effective:

  • Gene deletion and complementation: Creating precise tcpC deletion mutants using allelic exchange techniques provides a foundation for functional studies. Complementation with wild-type or modified tcpC variants can confirm phenotypes and test specific hypotheses about protein domains.

  • Site-directed mutagenesis: Introducing specific amino acid substitutions allows identification of critical functional residues, particularly at predicted interaction interfaces with TcpQ or other TCP components.

  • Transposon mutagenesis: Random transposon insertion libraries can identify suppressor mutations that restore function in tcpC mutants, revealing genetic interactions. This approach was successfully employed to identify other components of the TCP biogenesis pathway .

  • Fluorescent protein fusions: C-terminal or internal fusion constructs (if designed to minimize functional disruption) can enable visualization of tcpC localization and dynamics.

For optimal results, genetic modifications should be introduced into the native chromosomal locus rather than on plasmids to maintain physiological expression levels. Experimental design must account for potential polar effects on downstream genes in the tcp operon.

How can protein-protein interactions involving tcpC be identified and characterized?

Identifying the interaction partners of tcpC is essential for understanding its functional role in TCP biogenesis. Several complementary methodologies are recommended:

  • Co-immunoprecipitation (Co-IP): Using antibodies against tcpC or epitope-tagged versions to pull down interacting proteins from membrane fractions. This technique has been useful in confirming the TcpC-TcpQ interaction .

  • Bacterial two-hybrid (BTH) assays: While traditional yeast two-hybrid systems are unsuitable for membrane proteins, specialized bacterial two-hybrid systems have been developed for membrane protein interactions and can detect tcpC interactions with other TCP components.

  • Cross-linking coupled with mass spectrometry: Chemical cross-linking of neighboring proteins followed by mass spectrometric identification can capture transient or weak interactions within the TCP machinery.

  • Surface plasmon resonance (SPR): For quantitative measurement of binding kinetics between purified tcpC and potential interaction partners.

  • Förster resonance energy transfer (FRET): For detecting interactions in living cells when protein functionality permits fluorescent protein fusions.

The choice of method depends on the specific research question, with Co-IP being most suitable for confirming suspected interactions and cross-linking/MS being more appropriate for unbiased identification of the complete tcpC interactome.

What are the optimal experimental designs for functional studies of tcpC?

When designing experiments to evaluate tcpC function, researchers should consider multiple complementary approaches:

  • Phenotypic characterization: Compare wild-type, tcpC deletion mutants, and complemented strains for:

    • TCP production (by electron microscopy and immunoblotting)

    • Autoagglutination (a TCP-dependent phenotype)

    • CTX phage transduction (TCP serves as the CTX phage receptor)

    • Colonization efficiency in animal models

  • Structure-function analysis: Create a panel of mutations targeting specific domains and evaluate their impact on function. This should include:

    • Systematic alanine scanning of conserved residues

    • Domain swapping with homologous proteins

    • Deletion of specific structural elements

  • Localization studies: Determine if tcpC correctly localizes to the outer membrane and forms discrete complexes using:

    • Membrane fractionation followed by immunoblotting

    • Immunofluorescence microscopy

    • Immunogold electron microscopy

The experimental approach should implement quasi-experimental designs when randomized controlled trials are impractical, such as when comparing different bacterial strains or culture conditions . For instance, interrupted time series designs can effectively track changes in TCP expression under varying conditions.

How does the TcpC-TcpQ outer membrane complex assemble and function?

The TcpC-TcpQ complex represents a specialized machinery for TCP biogenesis, but its assembly pathway and mechanistic function remain incompletely understood. Current research suggests the following model:

  • Assembly pathway: TcpC and TcpQ are likely inserted into the outer membrane via the β-barrel assembly machinery (BAM) complex. Their interaction may occur either during membrane insertion or post-insertion.

  • Structural organization: Bioinformatic analyses predict that tcpC forms a β-barrel structure with exposed loops in both the periplasm and extracellular space. These loops likely mediate interactions with TcpQ and other TCP components.

  • Functional mechanism: The complex likely forms a protected channel through which pilus subunits are transported and assembled at the cell surface. TcpC may provide the channel while TcpQ could function in recruiting other components or regulating channel activity.

Research approaches to elucidate this complex should include:

  • Cryo-electron tomography to visualize the complex in situ

  • In vitro reconstitution of the minimal machinery required for pilus assembly

  • Single-particle tracking to study dynamics of complex formation

What are the structural determinants of tcpC function in TCP biogenesis?

Understanding the structure-function relationship of tcpC requires detailed analysis of its domains and critical residues:

  • Predicted domain organization:

    • N-terminal signal sequence for Sec-dependent transport

    • Transmembrane β-barrel domain

    • Periplasmic domains involved in interactions with other TCP components

    • Extracellular loops potentially involved in pilus assembly

  • Critical functional elements:

    • Conserved residues across Vibrio species likely indicate functionally important sites

    • Charged residues in periplasmic domains may mediate protein-protein interactions

    • The β-barrel structure must maintain a specific diameter to accommodate passage of pilus subunits

  • Structural analysis approaches:

    • X-ray crystallography or cryo-EM of purified tcpC

    • Hydrogen-deuterium exchange mass spectrometry to identify regions protected by protein-protein interactions

    • Molecular dynamics simulations to predict conformational changes during pilus assembly

The structural features of tcpC likely reflect evolutionary adaptations specific to the TCP system, distinguishing it from related secretion systems in other bacteria.

How can recombinant tcpC be optimally expressed and purified for structural studies?

Expression and purification of membrane proteins like tcpC present significant technical challenges. Based on successful approaches with similar outer membrane proteins, the following protocol is recommended:

  • Expression system selection:

    • E. coli C41(DE3) or C43(DE3) strains engineered for membrane protein expression

    • PMSF vector with a pelB leader sequence for periplasmic targeting

    • Codon optimization for the expression host

    • Low-temperature induction (16-20°C) to minimize inclusion body formation

  • Purification strategy:

    • Membrane fractionation using sucrose gradient ultracentrifugation

    • Selective extraction of outer membrane proteins using N-lauroylsarcosine

    • Solubilization with mild detergents (DDM, LDAO, or C8E4)

    • Affinity chromatography using C-terminal His-tag

    • Size-exclusion chromatography for final purification

  • Quality control assessments:

    • Circular dichroism to confirm secondary structure

    • Thermal stability assays to optimize buffer conditions

    • Analytical ultracentrifugation to assess homogeneity

    • Functionality tests using liposome reconstitution

Purification StepMethodCritical Parameters
Cell lysisMechanical disruption (French press)Buffer: 20 mM Tris-HCl pH 8.0, 150 mM NaCl, protease inhibitors
Membrane isolationUltracentrifugation (150,000×g, 1h)Complete removal of cytoplasmic proteins
Inner/outer membrane separationSucrose gradient (25-55%)Sharp separation of membrane fractions
Outer membrane protein extraction0.5% N-lauroylsarcosine treatmentSelective solubilization of inner membrane proteins
Protein solubilization1% DDM, 1 hour, 4°CComplete solubilization without denaturation
Affinity purificationNi-NTA chromatography5-20 mM imidazole in wash buffer to reduce non-specific binding
Size exclusionSuperdex 200Buffer containing 0.05% DDM to maintain protein solubility

How can tcpC function be assessed in the context of TCP biogenesis?

Several experimental approaches can assess tcpC function in TCP biogenesis:

  • Electron microscopy analysis: Negative staining and transmission electron microscopy remain the gold standards for visualizing TCP production. Quantification of pilus formation in wild-type versus tcpC mutants provides direct evidence of functional impact.

  • Autoagglutination assays: TCP-expressing V. cholerae cells aggregate and settle in static cultures. The rate and extent of autoagglutination correlate with TCP production and can be quantified spectrophotometrically.

  • CTX phage transduction: Since TCP serves as the receptor for CTX phage, susceptibility to phage infection directly reflects functional TCP on the cell surface. Transduction frequency can be quantified by selecting for phage-encoded antibiotic resistance.

  • In vitro pilus assembly: Development of cell-free systems containing purified components of the TCP machinery would allow direct assessment of tcpC's role in pilus polymerization under controlled conditions.

  • Mouse colonization models: The infant mouse colonization model provides an in vivo assessment of TCP function. Competitive index experiments comparing wild-type and tcpC mutants can quantify the colonization defect.

What is the relationship between tcpC and other virulence factors in V. cholerae?

TcpC functions within the broader context of V. cholerae virulence:

  • Coordinate regulation: TcpC expression is regulated as part of the ToxR regulon, which coordinates expression of multiple virulence factors including cholera toxin . This ensures that all components required for successful infection are expressed simultaneously in response to appropriate environmental cues.

  • TCP-dependent CTX phage acquisition: TCP serves as the receptor for CTX phage, which carries the genes encoding cholera toxin. Thus, tcpC indirectly influences horizontal acquisition of toxin genes through its role in TCP biogenesis.

  • TCP-mediated colonization: By enabling TCP formation, tcpC contributes to intestinal colonization, which is a prerequisite for delivery of other virulence factors like cholera toxin to the host.

  • Potential interactions with other secretion systems: V. cholerae possesses multiple secretion systems for different substrates. Cross-talk between these systems may occur at the level of shared components, regulatory networks, or competition for resources.

Understanding these relationships requires integrative approaches combining transcriptomics, proteomics, and functional genomics to map the complete network of interactions among virulence factors.

How do experimental design considerations impact tcpC research outcomes?

Successful research on tcpC requires careful attention to experimental design:

  • Growth conditions: TCP expression is highly sensitive to environmental conditions. Standardized culture conditions (AKI conditions: static growth at 37°C in AKI medium for 4 hours, followed by shaking for 4 hours) are essential for reproducible results.

  • Strain selection: Different V. cholerae strains show variations in TCP regulation and expression. Classical biotype strains typically express TCP under a broader range of conditions than El Tor biotype strains. Researchers should clearly specify strain backgrounds and consider testing findings in multiple strain backgrounds.

  • Control groups: Appropriate controls must include:

    • Wild-type positive control

    • Known TCP-deficient mutant (e.g., tcpA deletion) as negative control

    • Complemented tcpC mutant to confirm phenotype specificity

  • Quantitative assessment: Implementation of quantitative rather than qualitative measures improves reproducibility and allows statistical analysis. For example, applying interrupted time series analysis can reveal subtle phenotypes that might be missed in endpoint measurements .

  • Biological replicates: Minimum of three independent biological replicates with appropriate statistical analysis should be standard practice.

When designing experiments involving recombinant tcpC, researchers should implement a Technology Control Plan (TCP) if working with potentially controlled biological materials, especially in collaborative international research .

What emerging technologies show promise for advancing tcpC research?

Several cutting-edge approaches are poised to transform our understanding of tcpC:

  • Cryo-electron tomography: This technique can visualize the TCP machinery in situ, providing structural insights in the native cellular context without artifacts from protein purification or crystallization.

  • Single-molecule tracking: Super-resolution microscopy combined with protein labeling can track the movement and assembly of individual tcpC molecules in living cells, revealing dynamics invisible to static imaging approaches.

  • Native mass spectrometry: Recent advances allow analysis of intact membrane protein complexes with bound lipids, potentially revealing the complete composition of the TcpC-containing complex.

  • AlphaFold and machine learning approaches: These computational tools can predict protein structures and interactions with increasing accuracy, generating testable models of tcpC structure and its interactions with other TCP components.

  • CRISPR interference and CRISPRi-seq: These approaches enable precise, titratable control of gene expression and genome-wide screens for genetic interactions with tcpC, potentially revealing new components of the TCP biogenesis pathway.

How can contradictions in tcpC research data be resolved?

When researchers encounter conflicting data regarding tcpC function or properties, systematic troubleshooting approaches should be implemented:

  • Strain-specific effects: Test whether discrepancies arise from strain background differences by performing parallel experiments in multiple well-characterized V. cholerae strains.

  • Conditional phenotypes: Evaluate whether contradictory results reflect condition-specific effects by testing function under various growth conditions, including those that mimic different stages of infection.

  • Methodological differences: Implement standardized protocols across laboratories, with detailed reporting of methodological parameters to identify sources of variation.

  • Protein stability and folding issues: For recombinant protein studies, assess whether contradictory results stem from protein misfolding using quality control measures like circular dichroism and thermal stability assays.

  • Meta-analysis approaches: When literature reports conflict, formal meta-analysis combining data from multiple studies can identify factors contributing to heterogeneity and establish consensus findings.

The systematic application of experimental designs like quasi-experimental approaches with appropriate controls can help resolve apparent contradictions in research findings .

How can researchers optimize immunological detection of tcpC?

Developing effective immunological tools for tcpC detection requires specific strategies:

  • Antigen selection: For antibody production, select peptide antigens from predicted exposed loops rather than transmembrane regions. Alternatively, use purified recombinant tcpC refolded in detergent micelles as immunogen.

  • Antibody validation: Validate antibody specificity using:

    • Western blots comparing wild-type and tcpC deletion strains

    • Competitive inhibition with purified protein or peptide

    • Immunoprecipitation followed by mass spectrometry

  • Sample preparation for immunodetection:

    • For Western blots: Avoid boiling samples (which can cause aggregation); instead use mild denaturation (37°C in sample buffer)

    • For immunofluorescence: Optimize fixation methods to preserve epitope accessibility while maintaining membrane integrity

  • Epitope tagging alternatives: When antibodies against native tcpC are unavailable, consider epitope tagging (His, FLAG, etc.) at permissive sites identified through topology prediction and functional studies.

What bioinformatic approaches are most valuable for tcpC research?

Computational methods provide valuable insights into tcpC:

  • Homology identification: PSI-BLAST and HHpred can identify distant homologs in other secretion systems, revealing evolutionarily conserved functional elements.

  • Structural prediction:

    • β-barrel prediction algorithms (BOCTOPUS, PRED-TMBB)

    • AlphaFold for full structure prediction

    • Molecular dynamics simulations to predict protein behavior in membranes

  • Functional motif identification:

    • Conserved domain analysis across Vibrio species

    • Comparison with functionally similar proteins in other pilus systems

    • Prediction of protein-protein interaction sites

  • Genomic context analysis:

    • Examination of tcp operon structure across Vibrio species

    • Identification of potential regulatory elements

    • Coevolution analysis to predict interacting partners

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.