Recombinant Vibrio cholerae serotype O1 Toxin coregulated pilus biosynthesis protein D (tcpD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its incorporation.
Synonyms
tcpD; VC_0833; Toxin coregulated pilus biosynthesis protein D; TCP pilus biosynthesis protein TcpD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-278
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Target Names
tcpD
Target Protein Sequence
MVNVIMKISSLKKGSNFSINIKNIKLDKKLLVAIIFLVLSILGGGAYLYYENEKTKKLEQ ARLQKIQKENSDKQTYLSDFKSAFEGLDYQALTGFYDVLRSDIDFFRVNNWLLDVMDCNV NCNLAFKRGSFDTFTYLEMNRNGAVIKPQFDQNKLQFANVDYISGFRSIYLKDLTEQERD KSENIIEQCSTKLSELYNLQLLMKEQVKFKINLPRNVTSISGYDWVKNSDIKFGSIEIEN MPEKNLGLMKNIMNNSMMITSISLQNSSFKSKLNYYCY
Uniprot No.

Target Background

Function
Involved in TCP pilus biogenesis.
Database Links

KEGG: vch:VC0833

STRING: 243277.VC0833

Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the role of TcpD in the TCP biosynthesis system of Vibrio cholerae?

TcpD functions as a component of the toxin-coregulated pilus (TCP) biosynthesis apparatus in Vibrio cholerae and is encoded within the tcpA operon on the 40-kb pathogenicity island that contains multiple virulence factors . As part of the type IVb pilus (T4bP) system, TcpD likely contributes to the assembly, stabilization, or regulation of the pilus structure. The TCP system plays a crucial role in V. cholerae infection by mediating bacterial-bacterial interactions that protect cells from intestinal shear forces and by serving as the receptor for the CTXφ bacteriophage, which carries the cholera toxin genes .

While specific molecular functions of TcpD are not fully characterized in the available literature, research on related TCP proteins suggests it participates in the complex pilus biogenesis machinery. By comparison with other pilus systems, TcpD likely interacts with additional TCP proteins to facilitate proper pilus assembly and function, making it an important target for virulence studies and potential therapeutic interventions.

How does TcpD differ structurally and functionally from other TCP proteins like TcpA, TcpB, and TcpF?

TcpD differs significantly from other TCP proteins in both structure and function within the pilus assembly system:

  • TcpA: Functions as the major pilin subunit that forms the structural backbone of the TCP filament. TcpA contains a globular C-terminal domain (amino acids 55-224) that contributes to pilus assembly and stability .

  • TcpB: Acts as a minor pilin that plays a critical role in recognizing and binding to TcpF, facilitating the secretion mechanism through pilus elongation and retraction. Structural studies have revealed that TcpB forms a trimeric interface that interacts with the N-terminus of TcpF .

  • TcpF: Serves as a secreted protein that interacts with TcpB. Upon binding to TCP, TcpF forms a flower-shaped homotrimer with its flexible N-terminus hooked onto the trimeric interface of TcpB . TcpF secretion is crucial for V. cholerae colonization.

  • TcpD: As a pilus biosynthesis protein (VC0833), TcpD likely functions in the assembly machinery of the pilus structure . Unlike TcpA (the structural component) or TcpF (a secreted factor), TcpD probably functions within the membrane-associated complex that orchestrates pilus biogenesis.

Understanding these functional differences is essential for designing experiments that target specific aspects of TCP biogenesis and function in pathogenesis studies.

What are the optimal expression systems for producing soluble recombinant TcpD protein?

Based on successful approaches with related TCP proteins, several expression systems can be optimized for recombinant TcpD production:

E. coli-based expression systems:

  • pBAD vector system: This arabinose-inducible system has proven effective for expressing other TCP proteins, such as TcpP, with tight regulation allowing for controlled expression levels . This can be particularly beneficial for potentially toxic membrane-associated proteins like TcpD.

  • tac promoter system: High-yield expression has been achieved for cholera toxin B subunit using the tac promoter in wide host range plasmids . This system provided 10- to 100-fold higher expression levels compared to other systems and could be adapted for TcpD expression.

Expression optimization strategies:

  • Temperature modulation: Lower induction temperatures (16-25°C) often increase solubility of recombinant proteins

  • Fusion tags: N-terminal fusion with solubility-enhancing tags (MBP, SUMO, Thioredoxin)

  • Codon optimization: Adjust codon usage for E. coli expression

  • Co-expression with chaperones: GroEL/GroES can assist proper folding

Expression SystemAdvantagesChallengesRecommended Conditions
pBAD vectorTight regulation, tunable expressionLower yields at full induction0.002-0.2% arabinose, 25°C, 16h
pET vectorHigh expressionPotential inclusion body formation0.1-0.5mM IPTG, 16-25°C, 16-20h
tac promoterProven success with CT proteinsPotential leaky expression0.1-1.0mM IPTG, 30°C, OD600=0.6-0.8
Native V. choleraeNatural folding environmentLower yields, more complex purificationSelective medium with appropriate inducers

When expression results in inclusion bodies, transverse urea gradient electrophoresis (TUGE) can be employed to test protein refolding capability, as demonstrated with TcpA-C domain .

What are the most effective methods for purifying recombinant TcpD while maintaining its native conformation?

Purification of recombinant TcpD requires a strategic approach to preserve its native conformation:

For soluble fraction purification:

  • Affinity chromatography: His-tag affinity purification using Ni-NTA columns with a gradient elution (50-250mM imidazole) to minimize contaminants

  • Size exclusion chromatography: Further purification based on molecular size to remove aggregates and obtain homogeneous protein

  • Ion exchange chromatography: Based on predicted isoelectric point of TcpD

For inclusion body recovery and refolding:

  • Isolation protocol: Wash inclusion bodies with detergents (0.5% Triton X-100) and low concentrations of urea (1-2M) to remove contaminants

  • Solubilization: Use 8M urea or 6M guanidine-HCl to completely solubilize the protein

  • Refolding approach: Develop a refolding protocol based on TUGE data as demonstrated with TcpA-C domain

    • Gradual dialysis against decreasing urea concentrations

    • Addition of redox pairs (GSH/GSSG) to facilitate disulfide bond formation

    • Inclusion of stabilizing agents (L-arginine, glycerol)

  • Final polishing: Remove misfolded species via size exclusion chromatography

Quality assessment methods:

  • Circular dichroism (CD) spectroscopy to verify secondary structure

  • Differential scanning calorimetry to assess thermal stability

  • Analytical ultracentrifugation to confirm proper oligomeric state

  • Limited proteolysis to evaluate conformational integrity

When working with TcpD, it's critical to validate the final product's conformational state through both biophysical and functional assays to ensure it represents the native protein form.

What structural domains of TcpD are critical for its function in TCP biogenesis?

Based on comparative analysis with other TCP proteins, several structural features likely influence TcpD function:

Predicted key structural domains:

  • N-terminal signal sequence or transmembrane domain: Likely critical for proper localization within the membrane-associated TCP apparatus, similar to how TcpP contains a hydrophobic transmembrane segment (Ile-141 to Gln-169) .

  • Periplasmic domain: Potentially involved in protein-protein interactions with other TCP components during pilus assembly, analogous to how TcpH has a large periplasmic domain that enhances TcpP activity .

  • Conserved motifs: Analysis of TCP proteins reveals conserved regions shared among type IVb pilus proteins that may participate in protein-protein interactions essential for pilus biogenesis.

Structure-function relationships:
To determine which domains are critical, researchers should consider:

  • Generating truncated variants of TcpD lacking specific domains

  • Creating point mutations in conserved residues

  • Analyzing cross-linking patterns with other TCP proteins

  • Performing complementation studies with mutant variants in ΔtcpD strains

Without specific structural data on TcpD available in the search results, researchers should employ comparative analysis with better-characterized TCP proteins like TcpA, TcpB, and TcpP to guide initial structure-function studies.

How can we determine the interaction partners of TcpD within the TCP biogenesis apparatus?

Several complementary approaches can effectively map TcpD's interaction network:

In vitro interaction analysis:

  • Pull-down assays: Using purified His-tagged TcpD to capture interaction partners from V. cholerae lysates

  • Surface plasmon resonance (SPR): Measuring direct binding kinetics between TcpD and purified TCP components

  • Isothermal titration calorimetry (ITC): Determining thermodynamic parameters of specific TcpD interactions

In vivo interaction mapping:

  • Bacterial two-hybrid screening: Testing pairwise interactions between TcpD and other TCP proteins

  • Co-immunoprecipitation: Using antibodies against TcpD to isolate protein complexes

  • Chemical cross-linking coupled with mass spectrometry: Capturing transient interactions within the TCP apparatus

  • Fluorescence resonance energy transfer (FRET): Analyzing protein proximity in living cells with fluorescently tagged proteins

Genetic approaches:

  • Suppressor mutation analysis: Identifying secondary mutations that restore function in tcpD mutants

  • Synthetic lethality screening: Finding genes whose disruption is lethal only in combination with tcpD mutations

Structural biology approaches:

  • X-ray crystallography of TcpD complexes: Similar to how TcpB-TcpF complex structures revealed interaction mechanisms

  • Cryo-electron microscopy: Visualizing the entire TCP apparatus with TcpD in context

By integrating data from multiple approaches, researchers can build a comprehensive model of TcpD's position and function within the TCP biogenesis machinery.

How does disruption of the tcpD gene affect V. cholerae colonization in animal models?

Disruption of tcpD is expected to significantly impact V. cholerae colonization based on the critical role of the TCP apparatus in pathogenesis:

Expected phenotypes of tcpD mutants:

  • Colonization deficiency: TcpD mutants likely show reduced ability to colonize the intestinal epithelium in infant mouse models, similar to mutations in other tcp genes

  • Attenuated TCP production: Defects in pilus biogenesis would reduce visible pili in electron microscopy studies

  • CTXφ resistance: Reduced or absent TCP would prevent uptake of the CTXφ bacteriophage, similar to what has been observed with tcpP deletion mutants

  • Altered biofilm formation: TCP contributes to bacterial aggregation, so tcpD mutations may affect biofilm development

Experimental approaches:

  • Infant mouse colonization assays: Comparing colonization efficiency of wild-type vs. tcpD mutants

  • Competition assays: Co-inoculating wild-type and mutant strains to determine competitive index

  • Tissue culture adhesion studies: Measuring attachment to intestinal epithelial cell lines

  • CTXφ transduction efficiency: Quantifying susceptibility to phage infection

Potential complementation strategies:

  • In trans expression of wild-type tcpD

  • Site-directed mutagenesis to identify critical residues

  • Domain swapping with homologous proteins to determine functional conservation

It is important to note that while specific data on tcpD mutants is not provided in the search results, the well-established role of the TCP apparatus in virulence suggests that disruption of any component will likely attenuate colonization and pathogenesis.

Can recombinant TcpD be utilized in vaccine development strategies against V. cholerae?

Recombinant TcpD shows potential as a vaccine component based on several considerations:

Vaccine potential of TcpD:

  • Antigenic properties: As a component of TCP, TcpD may elicit antibodies that disrupt pilus biogenesis

  • Conservation: Analysis of sequence conservation across V. cholerae strains would determine if TcpD is sufficiently conserved to provide broad protection

  • Accessibility: The cellular localization of TcpD would influence its accessibility to antibodies

Potential vaccine strategies:

  • Subunit vaccines: Purified recombinant TcpD, potentially in combination with other TCP components

  • Live attenuated strains: ΔtoxA V. cholerae expressing increased levels of TcpD

  • Multivalent approaches: Combining TcpD with other antigens like CTB, which has been successfully overexpressed in recombinant systems

Methodological considerations:

  • Adjuvant selection: Appropriate adjuvants to enhance TcpD immunogenicity

  • Delivery routes: Oral vs. parenteral administration strategies

  • Fusion protein approaches: Creating TcpD-CTB fusions to enhance immunogenicity and mucosal targeting, similar to the CTB overexpression system that allows for peptide antigen fusions

Development pathway:

  • Antigenicity testing: Evaluating antibody responses in animal models

  • Protection assays: Challenging immunized animals with virulent V. cholerae

  • Epitope mapping: Identifying immunodominant regions of TcpD

  • Safety and immunogenicity trials: Following successful preclinical studies

The successful overexpression of CTB in V. cholerae strains for vaccine development provides a model for TcpD-based vaccine strategies.

How can CRISPR-Cas9 genome editing be optimized for studying tcpD function in V. cholerae?

CRISPR-Cas9 offers powerful approaches for precise genetic manipulation of tcpD:

Optimized CRISPR-Cas9 strategies for V. cholerae:

  • Delivery methods:

    • Conjugation-based transfer of CRISPR plasmids from E. coli to V. cholerae

    • Electroporation of CRISPR-Cas9 ribonucleoprotein complexes

  • Guide RNA design:

    • Target unique regions within tcpD to minimize off-target effects

    • Consider PAM site availability and GC content optimization

    • Design multiple gRNAs targeting different regions of tcpD

  • Editing approaches:

    • Knockout studies: Complete deletion or premature stop codon insertion

    • Point mutations: Introducing specific amino acid changes to study structure-function relationships

    • Domain swaps: Replacing portions of tcpD with homologous regions from related proteins

    • Tagging strategies: Inserting epitope tags or fluorescent proteins for localization studies

  • Screening methods:

    • PCR-based screening for genomic modifications

    • Phenotypic selection using CTXφ-Kan phage resistance as performed with other TCP mutants

    • FACS-based screening for fluorescently tagged variants

Efficiency enhancement strategies:

  • Optimization of homology arm length (500-1000bp)

  • Counter-selection markers to enrich for edited cells

  • Inhibition of V. cholerae restriction systems

  • Temperature modulation during recovery phase

Validation approaches:

  • Whole genome sequencing to verify target modifications and detect off-target effects

  • Complementation studies with wild-type tcpD

  • Functional assays measuring TCP production and function

This approach builds upon established methodologies for creating precise mutations in V. cholerae genes as demonstrated with tcpP deletion strains .

What are the challenges and solutions in developing high-throughput screening systems to identify inhibitors of TcpD function?

Developing high-throughput screening (HTS) systems for TcpD inhibitors presents several challenges and potential solutions:

Key challenges:

  • Assay development: Establishing a quantifiable readout for TcpD function

  • Protein stability: Maintaining TcpD in a native-like conformation during screening

  • Specificity: Ensuring hits target TcpD rather than other TCP components

  • Physiological relevance: Correlating in vitro inhibition with in vivo efficacy

Potential screening approaches:

  • Biochemical assays:

    • Activity-based assays if TcpD possesses enzymatic function

    • Protein-protein interaction disruption assays with identified partners

    • Thermal shift assays to identify compounds that alter TcpD stability

  • Cell-based systems:

    • Reporter strains with TCP-dependent phenotypes

    • CTXφ-Kan phage transduction efficiency as a TCP function readout

    • Bacterial two-hybrid systems monitoring TcpD interactions

  • Virtual screening:

    • In silico docking against predicted TcpD structure

    • Pharmacophore-based screening if binding pockets are identified

    • Fragment-based drug discovery approaches

Validation pipeline:

  • Primary screen in simplified system

  • Secondary confirmation assays

  • Dose-response studies

  • Selectivity profiling against other bacterial targets

  • Activity testing in V. cholerae cultures

  • In vivo efficacy in animal models

Researchers could adapt approaches used for studying other TCP components, such as the phage resistance assays employed for tcpP mutants , to develop TcpD-specific screening systems.

How can we overcome inclusion body formation when expressing recombinant TcpD in E. coli?

Inclusion body formation is a common challenge when expressing recombinant proteins in E. coli, as observed with TcpA-C domain where approximately 90% of the target polypeptide was found in cell debris . Several strategies can address this challenge:

Prevention strategies to enhance soluble expression:

  • Expression conditions optimization:

    • Reduce induction temperature to 16-20°C

    • Decrease inducer concentration for slower expression

    • Use rich media formulations like Terrific Broth

    • Implement auto-induction systems for gradual protein expression

  • Genetic modifications:

    • Codon optimization for E. coli

    • Fusion with solubility-enhancing tags (MBP, SUMO, Thioredoxin)

    • Co-expression of molecular chaperones (GroEL/GroES, DnaK/DnaJ)

    • Use of specialized E. coli strains (Origami, C41/C43, SHuffle)

  • Construct optimization:

    • Remove predicted disordered regions

    • Express individual domains separately

    • Test different N- and C-terminal boundaries

Recovery and refolding from inclusion bodies:
When prevention fails, inclusion bodies can be successfully utilized as demonstrated with TcpA-C :

  • Inclusion body isolation: Thorough washing with detergents and low concentration denaturants

  • Solubilization: Complete denaturation with 8M urea or 6M guanidine hydrochloride

  • Refolding protocol development:

    • Use TUGE to test protein folding capability under varying urea concentrations

    • Implement step-wise dialysis for gradual urea removal

    • Add folding enhancers like L-arginine, sucrose, or glycerol

    • Include redox pairs (GSH/GSSG) if disulfide bonds are present

  • Validation of refolded protein:

    • Circular dichroism to verify secondary structure

    • Fluorescence spectroscopy for tertiary structure assessment

    • Activity assays to confirm functionality

The successful refolding of TcpA-C from inclusion bodies resulting in a protein with "a globular conformation with a pronounced secondary structure and a rigid tertiary structure" provides a valuable model for TcpD recovery.

What are the best approaches for studying the dynamics of TcpD incorporation into the TCP apparatus in vivo?

Studying the dynamic incorporation of TcpD into the TCP biogenesis machinery requires advanced imaging and biochemical techniques:

Real-time imaging approaches:

  • Fluorescent protein fusions:

    • TcpD-GFP/mCherry fusions expressed from native locus

    • Super-resolution microscopy (PALM/STORM) for nanoscale localization

    • Dual-color imaging with other labeled TCP components

  • Time-lapse microscopy:

    • Tracking TcpD localization during TCP biogenesis

    • Inducible expression systems to follow new TcpD incorporation

    • Microfluidic systems for controlled growth conditions

  • Advanced imaging techniques:

    • Single-molecule tracking to follow individual TcpD molecules

    • FRET pairs to monitor protein-protein interactions in real time

    • Correlative light and electron microscopy for ultrastructural context

Biochemical and genetic approaches:

  • Pulse-chase experiments:

    • Metabolic labeling of newly synthesized TcpD

    • Time-course isolation of TCP apparatus to track incorporation

  • Inducible depletion systems:

    • Degron-tagged TcpD for controlled protein degradation

    • Monitoring TCP apparatus assembly after depletion/re-induction

  • Cross-linking studies:

    • Time-resolved cross-linking during TCP biogenesis

    • Mass spectrometry analysis of interaction dynamics

Complementary techniques:

  • Cryo-electron tomography:

    • Visualizing TCP apparatus in its cellular context

    • Capturing different assembly states

  • Single-cell transcriptomics/proteomics:

    • Correlating TcpD production with assembly stages

    • Identifying co-regulated factors

These approaches build upon methods used to study other TCP components, such as the TcpB-TcpF interaction , adapting them for dynamic in vivo analysis of TcpD incorporation into the growing TCP structure.

What are the most promising future research directions for understanding TcpD's role in V. cholerae pathogenesis?

Several high-priority research directions would significantly advance our understanding of TcpD:

  • Structural biology: Determining the three-dimensional structure of TcpD alone and in complex with interaction partners, similar to the elucidated TcpB-TcpF complex . This would provide critical insights into functional mechanisms.

  • Systems biology approach: Applying comprehensive gene expression analysis as demonstrated for other V. cholerae virulence factors to understand tcpD regulation under various environmental conditions.

  • Host-pathogen interaction studies: Investigating how TcpD and the TCP apparatus interact with host tissues and immune components during infection.

  • TcpD-targeted therapeutic development: Leveraging structural information to design specific inhibitors of TcpD function as potential novel anti-virulence agents.

  • Comparative analysis across strains: Examining tcpD sequence and functional conservation across classical and El Tor biotypes, as well as environmental isolates.

Integration of these research directions would provide a comprehensive understanding of TcpD's contribution to V. cholerae pathogenesis and potentially lead to new intervention strategies against this important global pathogen.

How can we integrate structural, functional, and in vivo data to build a comprehensive model of TcpD's role in TCP biogenesis?

Building an integrated model of TcpD function requires synthesizing multiple data types:

Data integration approaches:

  • Structural biology with functional validation:

    • Using crystal structures to guide mutational analysis

    • Structure-based prediction of interaction interfaces followed by in vivo validation

    • Molecular dynamics simulations to predict conformational changes

  • Multi-omics integration:

    • Correlating transcriptomics, proteomics, and interactomics data

    • Network analysis to position TcpD within the virulence regulation system

    • Temporal analysis of gene/protein expression during infection

  • In silico modeling with experimental validation:

    • Creating computational models of TCP assembly

    • Testing model predictions with targeted experiments

    • Iterative refinement based on experimental outcomes

  • Collaborative cross-disciplinary approaches:

    • Combining expertise in structural biology, microbial genetics, biochemistry, and infection models

    • Standardized protocols across research groups for data comparability

    • Open data sharing to accelerate discovery

Expected model components:

  • Spatial and temporal dynamics of TcpD during TCP biogenesis

  • Structural mechanism of TcpD function

  • Regulatory network controlling TcpD expression

  • Environmental signals modulating TcpD activity

  • TcpD contribution to host colonization

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.