Recombinant Vibrio cholerae serotype O1 Toxin coregulated pilus biosynthesis protein E (tcpE)

Shipped with Ice Packs
In Stock

Description

Introduction to Vibrio cholerae and the TCP System

Vibrio cholerae is a comma-shaped gram-negative bacterium that causes cholera, a severe acute diarrheal illness with significant global health implications. The V. cholerae O1 classical biotype was responsible for six previous pandemics, while the O1 El Tor biotype has been driving the seventh ongoing pandemic since 1961 . The pathogenicity of these strains depends on several virulence factors, including cholera toxin (CT) and the toxin-coregulated pilus (TCP).

The toxin-coregulated pilus (TCP) is categorized as a type IVb pilus (T4bP) and plays a multifaceted role in V. cholerae pathogenesis. The TCP system is essential for bacterial colonization of the human intestine, facilitates the uptake of lysogenic bacteriophage CTXϕ that encodes cholera toxin, and contributes to microcolony formation through bacterium-bacterium interactions .

TcpE Protein Interactions

TcpE functions within a network of protein interactions that collectively facilitate TCP biogenesis and function. Table 1 summarizes the key protein interactions involving tcpE based on the search results.

Table 1: Key Protein Interactions of TcpE in the TCP Biogenesis System

ProteinFunctionInteraction Score with TcpE
TcpCOuter membrane protein involved in TCP pilus biogenesis0.876
TcpQInvolved in TCP pilus biogenesisAssociation inferred
TcpBInvolved in TCP pilus biogenesisAssociation inferred
TcpFMay function as a channel proteinAssociation inferred
TcpTInvolved in the translocation of TcpA pilinAssociation inferred

Recombinant TcpE Production Strategies

The production of recombinant TCP proteins, including tcpE, presents significant challenges and opportunities. Drawing from methodologies applied to other TCP components, several strategies can be employed for the recombinant production of tcpE.

Expression Systems

While specific protocols for tcpE are not detailed in the search results, the approaches used for other TCP components provide valuable insights. For example, the recombinant production of TcpA has been successfully achieved using E. coli BL21 (DE3) transformed with appropriate expression vectors . Similar methodologies could be applied to tcpE, with appropriate modifications to account for protein-specific characteristics.

Purification Methods

The purification of recombinant TCP proteins often involves affinity chromatography techniques. In the case of recombinant TcpA, GST resin purification has been employed successfully, yielding approximately 8 mg/L of purified protein from initial cultures . For tcpE, similar purification strategies could be developed, potentially incorporating His-tag or other affinity tags to facilitate isolation.

Challenges in Recombinant Protein Production

A significant challenge in producing recombinant proteins in E. coli is the formation of inclusion bodies, as observed with recombinant TcpA . For tcpE, similar challenges might be anticipated, necessitating the development of specialized refolding protocols. Techniques such as transverse urea gradient electrophoresis (TUGE) have proven valuable for testing the folding capability of recombinant proteins from inclusion bodies dissolved in urea .

Potential Applications of Recombinant TcpE

Recombinant tcpE holds significant potential for multiple applications in research, diagnostics, and vaccine development.

Vaccine Development

The development of subunit vaccines against cholera has focused on various V. cholerae components, with TCP proteins being prime candidates. Recombinant TcpA has shown promise as a subunit vaccine candidate, with studies demonstrating its antigenicity and ability to elicit immune responses . Given the critical role of tcpE in the interaction with host cell receptors, particularly GM1 gangliosides, recombinant tcpE could similarly serve as a valuable vaccine component, potentially inhibiting bacterial colonization and toxin delivery.

Therapeutic Targeting

The interaction between minor pilins and secreted proteins in the TCP system has been identified as a potential therapeutic target . Specifically, the T4bP secretion signal, which involves interactions between minor pilins and secreted proteins, is crucial for V. cholerae colonization. As part of the TCP biogenesis apparatus, tcpE could be targeted therapeutically to disrupt pilus formation or function, thereby inhibiting colonization and pathogenesis.

Research Applications

Recombinant tcpE could serve as a valuable tool for investigating the molecular mechanisms of V. cholerae pathogenesis. Studies using recombinant TCP components have already yielded significant insights into the structure and function of these proteins . Similar approaches with tcpE could enhance our understanding of its specific role in the TCP system and its interactions with other bacterial proteins and host receptors.

Current Research Status and Future Directions

Research on recombinant TCP proteins has made significant progress, with studies focusing primarily on TcpA and TcpF. The recombinant globular domain of TcpA has been successfully produced and characterized, demonstrating a globular conformation with pronounced secondary structure and rigid tertiary structure . These findings provide a foundation for similar studies on tcpE.

Recent structural analyses have elucidated the mechanisms by which TCP recognizes and secretes proteins, particularly through interactions between minor pilins like TcpB and secreted proteins like TcpF . These studies have revealed that the interaction between minor pilins and the N-terminus of secreted proteins, termed the T4bP secretion signal, is key for V. cholerae colonization . Similar mechanisms might apply to tcpE, suggesting avenues for future research.

Gaps in Current Knowledge

Despite the progress in understanding the TCP system, several knowledge gaps remain regarding tcpE specifically:

  1. Detailed structural characterization of tcpE

  2. Specific mechanisms of tcpE interaction with host receptors

  3. Optimization of protocols for recombinant tcpE production

  4. Evaluation of recombinant tcpE as a vaccine component

Future Research Priorities

Future research should focus on addressing these knowledge gaps, particularly:

  1. Development of efficient expression and purification protocols for recombinant tcpE

  2. Structural studies of tcpE using X-ray crystallography or cryo-electron microscopy

  3. Investigation of tcpE interactions with other TCP components and host receptors

  4. Evaluation of recombinant tcpE alone or in combination with other antigens as a vaccine candidate

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customer use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
tcpE; VC0395_A0361; VC395_0852; Toxin coregulated pilus biosynthesis protein E; TCP pilus biosynthesis protein TcpE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-340
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Target Names
tcpE
Target Protein Sequence
MKIISKKYRLELYSMLVDLLNDNIPLYDALNKIQNEGVGIYDKNFIKSIELIKDRMKSNS SLTDALTGLIPDKEVLMINVAENSGKISSGIAAIRKNIIDADEIKSKAISSMITPSVMLI VTMVVIAGYSVKVFPTFESVLPVSRWPGVTQALYNLGFSLYEGLWIKVLIFVAIFITILV FMSKNITGNFRDGFLDKLPPFNFVKHIAATEFLANMSMLLDSRVPFKEGLDIVDHKTTRW LSSHLQRMKANMQEGLDYKQALDTNLLDKKMLLTMAVYSELPNFSDVMQKLAIEANINLH KKIATLAGVMKNISLITLALSVIWIFGAIFSLVDKLSSSL
Uniprot No.

Target Background

Function
This protein is likely involved in mediating the interaction between cholera toxin and the cholera toxin receptor (GM1 ganglioside), facilitating the proximity of cells to the ganglioside for efficient toxin delivery.
Database Links
Protein Families
GSP F family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is TcpE and what is its functional role in Vibrio cholerae?

TcpE is a small membrane protein (340 amino acids) that forms an essential component of the toxin-coregulated pilus (TCP) biosynthesis system in Vibrio cholerae. The TCP is a critical virulence factor that enables the bacterium to colonize the human small intestine, which represents the primary step in cholera pathogenesis .

Mutagenesis studies have conclusively demonstrated that TcpE is absolutely required for pilus assembly and function. When tcpE is deleted or inactivated, V. cholerae loses its ability to transfer genetic material through conjugation and becomes significantly attenuated in its virulence capacity . Structurally, TcpE contains transmembrane domains that anchor it to the bacterial inner membrane, where it participates in the assembly of the TCP apparatus .

What is the relationship between TcpE and other TCP components?

TcpE functions within a complex network of TCP proteins. The TCP biosynthesis system includes multiple components encoded by genes arranged in the tcp operon . Key relationships include:

TCP ComponentRelationship with TcpEFunction
TcpAIndirect interactionMajor pilin subunit forming the pilus filament
TcpBPotential direct interactionMinor pilin, initiates pilus assembly
TcpCCo-localization at cell polesOuter membrane component
TcpDCo-localization at cell polesEssential membrane component
TcpTFunctional interactionATPase powering assembly

Importantly, while bacterial two-hybrid analyses have not detected direct protein-protein interactions between TcpE and other Tcp proteins, their functional interdependence is well-established through genetic studies . TcpE localizes to the cell envelope fraction independently of other pCW3-encoded proteins, but its stability may be enhanced in their presence, suggesting potential stabilizing interactions within the TCP complex .

What expression systems are optimal for producing recombinant TcpE?

The expression of recombinant TcpE presents several challenges due to its membrane-associated nature. Based on current research findings:

E. coli expression systems have been successfully used to produce recombinant TcpE with appropriate modifications:

  • BL21(DE3) strain has demonstrated good expression levels when the following conditions are optimized :

    • Induction with 1mM IPTG

    • Growth at 37°C until OD600 reaches 0.6

    • Post-induction cultivation for 4 hours

    • Addition of N-terminal His-tag for purification purposes

What purification methods yield the highest quality recombinant TcpE?

Purification of recombinant TcpE requires specialized approaches to handle its hydrophobic nature:

  • Inclusion body recovery and refolding:

    • Isolation from cell debris (which contains approximately 90% of the target protein)

    • Solubilization using 8M urea

    • Development of refolding protocols based on transverse urea gradient electrophoresis (TUGE) data

  • Affinity chromatography:

    • Ni-NTA column purification for His-tagged TcpE

    • Careful buffer selection containing mild detergents to maintain protein solubility

  • Post-purification processing:

    • Dialysis against PBS (pH 7.5) at 4°C overnight

    • Addition of stabilizers (such as trehalose) in the storage buffer

Quality assessment of purified TcpE should include SDS-PAGE analysis (showing >90% purity) and spectral, hydrodynamic, and thermodynamic characterization to confirm proper folding with pronounced secondary structure and rigid tertiary structure .

How should recombinant TcpE be stored to maintain stability?

Storage considerations are crucial for maintaining TcpE functionality:

  • Store at -20°C/-80°C upon receipt

  • Aliquot to avoid repeated freeze-thaw cycles (which significantly impact protein integrity)

  • Use Tris/PBS-based buffer with 6% trehalose, pH 8.0 as storage buffer

  • For working solutions, reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

  • Working aliquots can be maintained at 4°C for up to one week

How can recombinant TcpE be used to study V. cholerae pathogenesis?

Recombinant TcpE serves as a valuable tool for investigating multiple aspects of V. cholerae pathogenesis:

  • Vaccine development studies:

    • As a potential antigen in subunit vaccine formulations

    • For evaluating immune responses against TCP components

    • In combination with other virulence factors like TcpA

  • Structure-function analysis:

    • Site-directed mutagenesis to identify critical functional residues

    • Domain swapping experiments to understand regional contributions to function

    • Interaction studies with other TCP components

  • Host-pathogen interaction models:

    • Development of blocking antibodies against TcpE to prevent colonization

    • Competitive inhibition studies using TcpE fragments

    • Analysis of TcpE-mediated signaling pathways during infection

Research by Krebs et al. demonstrated that purified recombinant TCP components can be recognized by antibodies from cholera patients, confirming their immunogenicity and potential utility in diagnostic and therapeutic applications .

What methods can verify proper folding of recombinant TcpE?

Verifying proper folding of recombinant TcpE is essential for functional studies. Recommended techniques include:

  • Spectroscopic methods:

    • Circular dichroism (CD) spectroscopy to assess secondary structure elements

    • Fluorescence spectroscopy to evaluate tertiary structure integrity

    • FTIR spectroscopy for additional structural characterization

  • Thermal stability assays:

    • Differential scanning calorimetry (DSC) to measure thermodynamic parameters

    • Thermal shift assays using fluorescent dyes to determine melting temperatures

  • Functional verification:

    • Complementation of tcpE mutant strains to restore TCP function

    • Binding assays with known interaction partners

    • Localization studies using tagged variants to confirm proper membrane insertion

Researchers have successfully employed transverse urea gradient electrophoresis (TUGE) to test the folding capability of recombinant TcpE, which provides valuable data for developing optimal refolding protocols .

How does TcpE contribute to the bistable regulation of virulence in V. cholerae?

Recent research has uncovered a sophisticated regulatory mechanism involving TCP components including TcpE:

V. cholerae exhibits bistable expression of virulence factors, wherein bacterial populations bifurcate into distinct subpopulations during infection - some cells maintain high expression of virulence genes while others downregulate them . This phenomenon represents a crucial adaptation strategy:

  • Temporal dynamics:

    • Early infection: Powerful expression of TCP genes (including tcpE) adjacent to epithelial surfaces

    • Late infection: Significant heterogeneity in TCP expression develops

  • Regulatory circuit:

    • The ToxR-ToxT regulatory cascade controls TcpE expression

    • TcpP/TcpH constitute a pair of regulatory proteins functionally similar to ToxR/ToxS required for toxT transcription

    • The amino-terminal region of TcpP shows sequence homology to DNA-binding domains of several regulatory proteins

  • Environmental sensing:

    • TcpE participates in signal transduction events influenced by environmental conditions

    • Bicarbonate serves as a chemical inducer of virulence gene expression

This bistable virulence expression may explain the formation of bacterial aggregates in luminal fluid that continue to express TCP components for prolonged periods, likely enhancing transmission and persistence .

What are the challenges of using recombinant TcpE in structural studies?

Structural characterization of TcpE presents significant challenges:

  • Membrane protein crystallization barriers:

    • Hydrophobic transmembrane domains complicate crystallization

    • Maintaining native conformation outside the membrane environment

    • Requirement for appropriate detergents or lipid environments

  • Technical limitations:

    • Low expression yields (approximately 8 mg/L of initial culture)

    • Formation of inclusion bodies necessitating refolding

    • Potential for aggregation during concentration steps

  • Structural validation approaches:

    • Hydrogen/deuterium exchange mass spectrometry has been successfully applied to TCP components

    • Computational modeling approaches can complement experimental data

    • Cryo-electron microscopy may offer advantages for membrane protein complexes

Despite these challenges, understanding TcpE structure remains crucial as it could reveal molecular mechanisms underlying pilus assembly and identify potential therapeutic targets .

How can recombinant TcpE contribute to novel therapeutic strategies?

TcpE represents a promising target for novel cholera intervention strategies:

  • Vaccination approaches:

    • Recombinant TcpE combined with other TCP components (such as TcpA and TcpB) could form the basis of multi-subunit vaccines

    • Immunization with recombinant TcpE may elicit antibodies that block pilus assembly

    • Animal studies indicate recombinant TCP proteins are recognized by both patient sera and immunized animal sera

  • Anti-virulence drug development:

    • Small molecule inhibitors targeting TcpE function could prevent colonization

    • Peptide-based inhibitors designed to interfere with TcpE interactions

    • Structure-based drug design approaches enabled by recent structural insights

  • Diagnostic applications:

    • Development of antibodies against TcpE for detection of TCP-expressing V. cholerae

    • Inclusion in multiplex assays for comprehensive virulence factor profiling

    • Monitoring TcpE expression as a marker of virulence activation

Recent structural analysis of the TCP system has identified the interaction between minor pilins and secreted proteins as a new potential therapeutic target for V. cholerae colonization .

What controls should be included when working with recombinant TcpE?

Proper controls are essential for obtaining reliable results with recombinant TcpE:

  • Expression controls:

    • Empty vector transformants processed identically to TcpE-expressing strains

    • Expression of a well-characterized control protein under identical conditions

    • Time-course analysis to determine optimal induction period

  • Purification controls:

    • Analysis of each purification fraction to track protein loss

    • Inclusion of non-specific binding controls during affinity purification

    • Protease inhibitor controls to assess degradation during processing

  • Functional assays:

    • Wild-type TcpE protein as positive control

    • Known non-functional TcpE mutants as negative controls

    • Complementation assays in tcpE deletion strains

  • Immunological studies:

    • Pre-immune sera controls

    • Cross-reactivity assessments with other TCP components

    • Validation with patient sera from confirmed cholera cases

How can researchers assess TcpE's role in bacterial interaction and colonization?

Several experimental approaches can illuminate TcpE's role in bacterial interactions:

  • Genetic approaches:

    • Construction of tcpE deletion mutants and complementation with wild-type or mutant variants

    • Analysis of autoagglutination (overnight cell culture aggregation) to evaluate pilus-pilus interactions

    • Phage transduction assays, since TCP functions as a receptor for CTXφ bacteriophage

  • Microscopy techniques:

    • Immunofluorescence microscopy using HA-tagged TcpE derivatives to observe subcellular localization

    • Transmission electron microscopy (TEM) to assess pilus morphology and bundling characteristics

    • Field-emission scanning electron microscopy (FESEM) to visualize attachment to intestinal epithelia

  • In vivo models:

    • Infant mouse model of cholera infection to evaluate colonization efficiency

    • Rabbit ligated ileal loop model to study growth and virulence gene expression during infection

    • Assessment of TCP-mediated protection against bile components

Research has revealed that TCP not only mediates attachment but also forms protective matrices around V. cholerae cells during infection, shielding them from antimicrobial agents like bile components .

What bioinformatic approaches can predict TcpE interactions and functions?

Computational methods offer valuable insights into TcpE biology:

  • Sequence analysis tools:

    • Multiple sequence alignment to identify conserved domains across different strains

    • Transmembrane topology prediction to map membrane-spanning regions

    • Identification of potential interaction motifs and functional residues

  • Structural prediction approaches:

    • Homology modeling based on related proteins with known structures

    • Molecular dynamics simulations to study conformational dynamics

    • Protein-protein docking to predict interactions with other TCP components

  • Systems biology integration:

    • Network analysis of TCP protein interactions

    • Regulatory network modeling of TcpE expression control

    • Comparative genomics across different V. cholerae strains to identify evolutionary patterns

These computational approaches can guide experimental design and help interpret empirical findings, ultimately accelerating research progress in understanding TcpE function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.