Recombinant Vibrio cholerae serotype O1 Toxin coregulated pilus biosynthesis protein P (tcpP)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Vibrio cholerae serotype O1 Toxin coregulated pilus biosynthesis protein P (TcpP)

Vibrio cholerae is a Gram-negative bacterium that causes cholera, a severe diarrheal disease. The pathogenicity of V. cholerae relies on its ability to colonize the host intestine and produce cholera toxin. Toxin-coregulated pilus biosynthesis protein P (TcpP) plays a crucial role in the virulence of V. cholerae . It is a membrane-bound transcriptional regulator that, along with TcpH, activates the transcription of toxT, a master regulator of various virulence factors .

Role of TcpP in Virulence Gene Expression

TcpP is essential for TCP production, as demonstrated by the deficiency in pili production in tcpP-deletion strains of V. cholerae . TcpP, along with ToxR, activates the transcription of the toxT gene, which is an essential activator of tcp operon transcription . The toxin-coregulated pilus (TCP) is vital for the pathogenicity of Vibrio cholerae, serving as an essential intestinal colonization factor and a receptor for CTXphi, the filamentous phage that encodes cholera toxin (CT) .

Regulation of TcpP Stability and Function

TcpH stabilizes TcpP and enhances its activity . The absence of TcpH leads to the degradation of TcpP . The periplasmic domain of TcpP is a target for protein degradation pathways that regulate TcpP levels . TcpH protects TcpP from regulated intramembrane proteolysis (RIP) through direct interaction, a process promoted by the dietary fatty acid α-linolenic acid .

Functional Analysis and Mutational Studies

  • Cysteine Residues: The cysteine residues in the periplasmic domain of TcpP are critical for its activation of toxT . Intermolecular disulfide bond formation in TcpP results in homodimerization and activation of virulence gene expression, while intramolecular disulfide bonds enhance TcpP stability .

  • TcpH Interaction: Mutants lacking TcpH express very low levels of TcpP, even though tcpP mRNA levels are unaffected . The periplasmic domain of TcpP is implicated in its degradation, as replacing it with that of ToxR results in a more stable protein .

TcpA Variants and Their Significance

Genetic variation at the tcpA locus in toxigenic isolates of V. cholerae has revealed novel TcpA sequences, which group into distinct clonal lineages . Polymorphisms in TcpA are predominantly located in the carboxyl region and surface-exposed regions of TCP fibers .

TcpP and Host Interactions

V. cholerae uses exogenous α-linolenic acid to remodel the phospholipid bilayer in vivo, leading to the co-association of TcpP and TcpH within detergent-resistant membranes (DRMs), where RIP of TcpP is inhibited by TcpH . This process promotes V. cholerae pathogenicity .

Tables Summarizing Key Findings

FeatureDescriptionReference
RoleTranscriptional regulator, activates toxT
Partner ProteinTcpH, stabilizes TcpP
Cysteine ResiduesEssential for TcpP function and virulence
RegulationControlled by TcpH, AphA, and AphB
DegradationThe periplasmic domain of TcpP is a target for degradation
α-Linolenic AcidPromotes TcpH-dependent inhibition of RIP
TcpAThe toxin-coregulated pilus (TCP) is a critical determinant of the pathogenicity of Vibrio cholerae.
Intestinal Colonization FactorTCP serves as an essential intestinal colonization factor and also as a receptor for CTXphi, the filamentous phage that encodes cholera toxin (CT).

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tcpP; VC_0826; Toxin coregulated pilus biosynthesis protein P; TCP pilus biosynthesis protein TcpP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-221
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Target Names
tcpP
Target Protein Sequence
MGYVRVIYQFPDNLWWNECTNQVYYAQDPMKPERLIGTPSIIQTKLLKILCEYHPAPCPN DQIIKALWPHGFISSESLTQAIKRTRDFLNDEHKTLIENVKLQGYRINIIQVIVSENVVD EADCSQKKSVKERIKIEWGKINVVPYLVFSALYVALLPVIWWSYGQWYQHELAGITHDLR DLARLPGITIQKLSEQKLTFAIDQHQCSVNYEQKTLECTKN
Uniprot No.

Target Background

Function
Involved in TCP pilus biogenesis.
Database Links

KEGG: vch:VC0826

STRING: 243277.VC0826

Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the molecular function of TcpP in Vibrio cholerae virulence gene regulation?

TcpP functions as a membrane-localized transcription factor that cooperatively works with ToxR to activate toxT expression, which subsequently drives virulence factor production in V. cholerae. Structurally, TcpP contains an amino-terminal region with significant sequence homology to DNA-binding domains of several regulatory proteins, including ToxR from V. cholerae and PsaE from Yersinia pestis, along with a hydrophobic transmembrane segment (from Ile-141 to Gln-169) .

Experimental evidence demonstrates that TcpP is essential for pilus production, as tcpP-deletion strains exhibit deficient pili formation and dramatically reduced colonization capabilities . The protein activates transcription of the toxT gene, an essential activator of tcp operon transcription, which ultimately controls the expression of cholera toxin and toxin-coregulated pilus (TCP) .

Methodologically, studies have confirmed TcpP's role through complementation experiments, where plasmids expressing toxT can restore TCP production in ΔtcpP mutant strains, indicating TcpP functions upstream of ToxT in the regulatory cascade .

How is TcpP expression and stability regulated at the molecular level?

TcpP levels are regulated through multiple mechanisms:

  • Transcriptional regulation: The promoter upstream of tcpPH is transcribed independently of ToxR and ToxT in classical V. cholerae strains and is regulated by environmental conditions such as temperature and pH .

  • Post-translational regulation: TcpP abundance is primarily controlled through a process called regulated intramembrane proteolysis (RIP). Experimental time course studies demonstrate that TcpP levels decrease dramatically over time when not protected by TcpH, despite unchanged tcpP mRNA levels .

  • Protein-protein interactions: TcpH directly interacts with TcpP, protecting it from proteolytic degradation. This interaction is essential for maintaining TcpP stability and function .

Research approaches for studying TcpP regulation typically involve:

  • Reporter gene constructs (e.g., toxT::lacZ) to monitor transcriptional activity

  • Western blotting for protein abundance analysis

  • Genetic manipulation (deletion/complementation)

  • Co-immunoprecipitation for protein interaction studies

What experimental models are most effective for studying TcpP function?

Several experimental systems have proven effective for TcpP research:

Model SystemApplicationsAdvantagesLimitations
In vitro recombinant protein studiesProtein-protein interaction, binding studiesDirect biochemical analysisMay not reflect in vivo complexity
Bacterial genetic systemsGene deletion, complementation assaysDirect assessment of gene functionPotential polar effects on downstream genes
Reporter constructs (toxT::lacZ)Transcriptional activity measurementQuantifiable readoutIndirect measure of activity
Neonate mouse modelColonization and virulence studiesIn vivo relevanceEthical considerations, species differences
Bacteriophage CTXΦ-Kan transductionSelection for TCP-producing cellsFunctional readoutRequires specialized virus stocks

For TCP production assessment, researchers frequently employ bacteriophage CTXΦ-Kan, which uses TCP as its receptor and carries a gene encoding kanamycin resistance . This provides a selective method for identifying TCP-producing cells under various experimental conditions.

How does α-linolenic acid modulate TcpP-TcpH interactions and impact virulence gene expression?

α-Linolenic acid, a dietary fatty acid, significantly enhances TcpP activity through a complex molecular mechanism involving membrane microdomains:

  • Membrane remodeling: Research demonstrates that V. cholerae cells utilize exogenous α-linolenic acid to remodel the phospholipid bilayer in vivo .

  • Protein co-localization: This remodeling promotes co-association of TcpP and TcpH molecules within detergent-resistant membranes (DRMs), specialized lipid microdomains .

  • Proteolysis inhibition: Within these DRMs, TcpH effectively inhibits regulated intramembrane proteolysis (RIP) of TcpP through direct protein-protein interaction .

The experimental evidence supporting this model includes:

  • Membrane fractionation studies showing co-localization of TcpP and TcpH in DRMs following α-linolenic acid treatment

  • Mutational analysis demonstrating the requirement of the TcpH transmembrane domain for this process

  • Colonization assays revealing enhanced virulence in the presence of α-linolenic acid

This mechanism represents a direct link between host dietary factors and bacterial virulence regulation, suggesting α-linolenic acid functions as an environmental signal that promotes V. cholerae pathogenicity . Methodologically, researchers investigating this phenomenon typically employ lipid supplementation experiments, membrane fractionation techniques, and protein stability assays.

What mechanisms underlie TcpH-mediated protection of TcpP from regulated intramembrane proteolysis?

TcpH protects TcpP from degradation through several coordinated mechanisms:

  • Direct protein interaction: Experimental evidence demonstrates that TcpH physically interacts with TcpP, forming a protective complex that prevents proteolytic enzymes from accessing TcpP cleavage sites .

  • Membrane domain reorganization: TcpH facilitates the localization of TcpP within detergent-resistant membrane microdomains (DRMs), which serve as protective environments against proteolytic enzymes .

  • Stabilization of protein conformation: Research suggests TcpH may induce conformational changes in TcpP that mask or alter accessibility to proteolysis sites .

The absence of tcpH leads to unimpeded degradation of TcpP in vitro and a significant colonization defect in neonate mouse models of V. cholerae infection . Methodologically, researchers have demonstrated this protection using:

  • Protein stability assays comparing TcpP levels in wild-type versus ΔtcpH strains

  • Time-course experiments showing TcpP degradation kinetics

  • Complementation studies where co-expression of TcpH rescues TcpP stability

  • Membrane fractionation to examine protein localization patterns

The two-step proteolytic process (RIP) that degrades TcpP in the absence of TcpH represents a major regulatory mechanism controlling V. cholerae virulence gene expression .

How does the cooperative action between ToxR and TcpP control toxT transcription?

The regulation of toxT transcription involves sophisticated cooperation between two membrane-localized transcription factor systems:

  • Protein complexes: Evidence suggests ToxR/ToxS and TcpP/TcpH may form higher-order regulatory complexes at the toxT promoter. Both protein pairs have similar membrane topologies, with cytoplasmic DNA-binding domains and periplasmic sensing domains anchored by transmembrane segments .

  • Promoter architecture: Experimental data indicate these factors may activate different elements within the toxT promoter region in a coordinated manner to achieve optimal expression .

  • Signaling integration: The membrane localization of these four regulatory proteins suggests their potential interaction with other membrane components, including motility and chemotaxis systems, allowing integration of multiple environmental signals .

Research approaches to study this cooperation include:

  • Chromatin immunoprecipitation to detect protein-DNA interactions

  • DNase footprinting to identify specific binding sites

  • Reporter gene assays using toxT promoter constructs with targeted mutations

  • Bacterial two-hybrid assays to detect protein-protein interactions

Experimental evidence shows that while a tcpP-expressing plasmid can weakly complement a toxR-deletion strain, a toxR-expressing plasmid cannot complement a tcpP-deletion strain, indicating TcpP functions downstream of or in parallel with ToxR in the regulatory hierarchy .

What strategies can be employed to express and purify recombinant TcpP for structural and functional studies?

Successful production of recombinant TcpP requires specialized approaches due to its transmembrane nature:

  • Expression systems optimization:

    • E. coli strains: C41(DE3) or C43(DE3) strains, designed for membrane protein expression

    • Expression vectors: pET-based systems with tunable induction or autoinduction capabilities

    • Fusion tags: MBP (maltose-binding protein) or SUMO tags improve solubility and folding

  • Membrane protein extraction protocols:

    • Gentle detergent solubilization (n-dodecyl-β-D-maltoside or CHAPS)

    • Bicelle or nanodisc incorporation for maintaining native-like environment

    • Stepwise optimization of detergent:protein ratios

  • Purification strategies:

    • Affinity chromatography (Ni-NTA for His-tagged constructs)

    • Size exclusion chromatography for oligomeric state determination

    • Ion exchange chromatography for final polishing

  • Functional validation assays:

    • DNA-binding assays using electrophoretic mobility shift assays with toxT promoter fragments

    • Protein-protein interaction studies with TcpH and ToxR

    • Lipid interaction analyses using liposome flotation assays

Though the search results don't provide specific purification protocols for TcpP, these approaches represent standard methodologies for membrane-associated transcriptional regulators with similar characteristics.

How can the TcpP-TcpH system be targeted for development of novel cholera therapeutics?

The TcpP-TcpH regulatory system presents several promising therapeutic intervention points:

  • Disruption of TcpP-TcpH interaction:

    • Small molecule inhibitors targeting the interaction interface

    • Peptide mimetics that compete with natural binding

    • Methodological approach: High-throughput screening of compound libraries using fluorescence-based interaction assays

  • Promotion of TcpP degradation:

    • Compounds that accelerate regulated intramembrane proteolysis

    • Molecules that prevent localization to protective membrane microdomains

    • Experimental approach: Protein stability assays in the presence of candidate compounds

  • Inhibition of TcpP-DNA binding:

    • Small molecules that interfere with the DNA-binding domain

    • Decoy DNA oligonucleotides mimicking toxT promoter elements

    • Methodology: DNA-protein interaction assays with purified components

  • Membrane microdomain disruption:

    • Compounds that interfere with α-linolenic acid-mediated membrane remodeling

    • Agents that disrupt detergent-resistant membrane formation

    • Research approach: Membrane fractionation studies and lipid raft analysis

Since V. cholerae continues to pose a significant global health burden with evolving multidrug-resistant strains, these alternative therapeutic approaches targeting virulence regulation rather than bacterial viability may reduce selection pressure and mitigate resistance development . Experimental methodologies typically involve screening compound libraries, structure-based drug design, and validation in both in vitro and in vivo models of infection.

What techniques are most effective for studying TcpP-TcpH interactions in living bacterial cells?

Several advanced techniques enable real-time study of TcpP-TcpH interactions:

  • Fluorescence resonance energy transfer (FRET):

    • TcpP and TcpH can be tagged with appropriate fluorophore pairs (e.g., CFP/YFP)

    • Interaction produces measurable energy transfer between fluorophores

    • Allows dynamic monitoring of protein-protein interactions in live cells

    • Challenge: Ensuring fluorescent tags don't disrupt protein function

  • Split fluorescent protein complementation:

    • TcpP and TcpH are tagged with complementary fragments of a fluorescent protein

    • Interaction reconstitutes functional fluorophore, generating detectable signal

    • Provides spatial information about interaction sites within the cell

    • Methodology requires validation of construct functionality

  • Crosslinking coupled with mass spectrometry:

    • Chemical crosslinkers stabilize transient protein-protein interactions

    • Mass spectrometry identifies interaction interfaces

    • Provides detailed structural information about the complex

    • Requires careful optimization of crosslinking conditions

  • Single-particle tracking:

    • Individual TcpP and TcpH molecules labeled with photoactivatable fluorescent proteins

    • Super-resolution microscopy tracks diffusion patterns and co-localization

    • Reveals dynamics of interaction in membrane microdomains

    • Technical challenge: Achieving sufficient spatial and temporal resolution

These approaches complement traditional biochemical methods such as co-immunoprecipitation and bacterial two-hybrid systems, providing dynamic, spatially resolved information about TcpP-TcpH interactions in their native cellular environment.

How can researchers effectively analyze the impact of environmental factors on TcpP-dependent gene regulation?

Environmental regulation of TcpP function can be systematically investigated using:

  • Transcriptional reporters under varied conditions:

    • Construct toxT::lacZ or toxT::gfp reporter fusions

    • Test multiple environmental parameters systematically:

      • pH gradients (6.5-8.5)

      • Temperature ranges (25°C-37°C)

      • Osmolarity variations

      • Presence of specific host-derived molecules

    • Allows high-throughput screening of environmental conditions

  • Membrane composition analysis:

    • Lipidomics to profile membrane changes in response to environmental shifts

    • Correlation of membrane profiles with TcpP activity and stability

    • Special focus on detergent-resistant membrane formation

    • Methodological requirement: Mass spectrometry capabilities

  • In vivo expression technology (IVET):

    • Identifies promoters activated during infection

    • Reveals environmental conditions naturally encountered by V. cholerae

    • Provides physiologically relevant parameters for in vitro studies

    • Technical challenge: Implementing in appropriate animal models

  • RNA-seq with environmental perturbations:

    • Global transcriptional profiling across environmental conditions

    • Identification of TcpP-dependent and independent responses

    • Network analysis to identify regulatory connections

    • Data analysis requirement: Advanced bioinformatics capabilities

Experimental evidence indicates that the addition of local anesthetics such as procaine to growth media strongly inhibits transcription of genes controlled by the ToxR/ToxT regulatory cascade, providing a useful experimental tool for manipulation of this pathway .

What are the current limitations in TcpP research and how might they be addressed?

Several technical and conceptual challenges currently limit TcpP research:

  • Membrane protein structural analysis limitations:

    • Challenge: Difficulty obtaining high-resolution structures of TcpP and TcpP-TcpH complexes

    • Solution approaches:

      • Cryo-electron microscopy for membrane protein complexes

      • NMR studies of individual domains

      • Computational modeling integrated with crosslinking distance constraints

  • Complexity of in vivo regulation:

    • Challenge: Multiple overlapping regulatory systems affecting virulence

    • Methodological solutions:

      • Single-cell analyses to capture heterogeneity in regulation

      • Simultaneous monitoring of multiple regulatory proteins

      • Systems biology approaches to model complex interactions

  • Environmental signal integration:

    • Challenge: Understanding how multiple signals are prioritized and integrated

    • Research approaches:

      • Development of microfluidic systems for precise environmental control

      • Mathematical modeling of multi-input regulatory networks

      • High-dimensional data analysis to identify emergent patterns

  • Translation to therapeutic development:

    • Challenge: Moving from mechanistic understanding to effective interventions

    • Strategic solutions:

      • Structure-based drug design targeting specific regulatory interactions

      • Phenotypic screening approaches focused on virulence inhibition

      • Development of better delivery systems for gut-targeted therapeutics

Addressing these limitations requires interdisciplinary approaches combining microbiology, structural biology, systems biology, and pharmaceutical sciences. The significance of such efforts is underscored by the continued global health impact of cholera and the emergence of multidrug-resistant strains .

How might single-cell technologies transform our understanding of TcpP regulation and function?

Emerging single-cell approaches offer unprecedented insights into TcpP biology:

  • Single-cell RNA sequencing applications:

    • Revealing population heterogeneity in virulence gene expression

    • Identifying distinct regulatory states within bacterial populations

    • Correlating TcpP activity with specific transcriptional signatures

    • Methodological requirement: Adaptation of scRNA-seq protocols for bacterial cells

  • Single-molecule imaging techniques:

    • Visualizing individual TcpP molecules within membrane microdomains

    • Tracking real-time dynamics of TcpP-TcpH interactions

    • Monitoring protein degradation at the single-molecule level

    • Technical challenge: Achieving sufficient spatial and temporal resolution

  • Microfluidic approaches:

    • Precise control of microenvironments for individual bacterial cells

    • Real-time monitoring of gene expression in changing conditions

    • Following lineage-specific regulation patterns through division

    • Implementation consideration: Integration with appropriate detection systems

  • Mass cytometry for protein analysis:

    • Simultaneous measurement of multiple proteins in single bacterial cells

    • Correlating TcpP levels with other regulatory and structural proteins

    • Identifying distinct cellular states associated with virulence

    • Methodological adaptation: Development of appropriate bacterial preparation protocols

These technologies will likely reveal previously unappreciated heterogeneity in bacterial virulence regulation, potentially explaining phenomena such as persistence and variable host colonization efficiency.

What is the potential for integrating host-microbiome interactions into TcpP research?

The interface between V. cholerae, TcpP regulation, and the host microbiome represents a fertile area for investigation:

  • Microbiome-derived metabolites affecting TcpP:

    • Systematic screening of microbiome-produced compounds for effects on TcpP stability

    • Focus on short-chain fatty acids and other membrane-active molecules

    • Potential discovery of natural inhibitors or activators

    • Methodological approach: Metabolomics coupled with functional assays

  • Polymicrobial interactions influencing virulence:

    • Co-culture systems with representative gut microbiota members

    • Effects on TcpP-dependent gene expression in complex communities

    • Identification of protective or synergistic microbial species

    • Technical implementation: Development of appropriate culture systems and detection methods

  • Host-microbiome-pathogen interaction models:

    • Gnotobiotic animal models with defined microbiota

    • Assessment of how specific microbiome compositions affect V. cholerae colonization

    • Correlation with TcpP activity and stability in vivo

    • Research consideration: Development of appropriate animal models and analysis tools

  • Therapeutic microbiome manipulation:

    • Probiotic approaches targeting TcpP-dependent virulence

    • Rational design of microbiome interventions based on TcpP regulation

    • Assessment of protective effects against cholera in model systems

    • Translational focus: Development of viable probiotic formulations

The discovery that dietary α-linolenic acid promotes V. cholerae pathogenicity through TcpP-TcpH interactions highlights the importance of understanding how host-derived and microbiome-derived factors influence virulence regulation, potentially leading to novel preventative and therapeutic strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.