Recombinant Vibrio cholerae serotype O1 Toxin coregulated pilus biosynthesis protein R (tcpR)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tcpR; VC0395_A0357; VC395_0848; Toxin coregulated pilus biosynthesis protein R; TCP pilus biosynthesis protein TcpR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Target Names
tcpR
Target Protein Sequence
MTSIWLHESDFRYVNLDVERYQKKYRLTLTNGNKYVFIKDKEDISDVNPFIPYILMEEGM NNVLVKSDDYKDILIYQGVNIQCLDFLNDNDISVEKLVDFETVELKADELNKIKARRLDA QLIEDEVKNNKVFIIGFIAIVIISIGVFWLM
Uniprot No.

Target Background

Function

Involved in TCP pilus biogenesis.

Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the role of Toxin coregulated pilus biosynthesis proteins in Vibrio cholerae pathogenesis?

Toxin coregulated pilus (TCP) proteins serve multiple critical functions in Vibrio cholerae pathogenesis. They are essential components of the type IV pilus system that enables V. cholerae to colonize the small intestine, a crucial step in pathogenesis. TCP functions in at least three key ways: (1) it serves as the receptor for CTXφ bacteriophage, which carries the genes encoding cholera toxin; (2) it secretes the colonization factor TcpF; and (3) it mediates bacterium-bacterium interactions that lead to microcolony formation, providing protection to the bacteria . These protective microcolonies are formed through self-association mediated by the long thin TCP filaments that belong to the type IV pilus family .

How does the TCP biogenesis pathway function in Vibrio cholerae?

The TCP biogenesis pathway in Vibrio cholerae involves several coordinated steps. TCP pilin precursors, including the major pilin TcpA and minor pilins like TcpB, are initially processed at the cytoplasmic side of the inner membrane by TcpJ, a type four prepilin peptidase (TFPP) . This processing removes the leader peptide from the precursor proteins. The mature pilin subunits then assemble into the TCP filament via the TCP biogenesis apparatus . The assembly process is likely facilitated by an assembly ATPase that provides energy for polymerization. The minor pilins, including potentially tcpR, play specialized roles in initiating pilus assembly, regulating pilus dynamics, or functioning at the pilus tip. In particular, TcpB has been shown to mediate pilus retraction, which is essential for CTXφ phage uptake .

What experimental techniques are commonly used to purify recombinant TCP proteins?

The purification of recombinant TCP proteins typically employs the following methodology:

  • Gene cloning: The target TCP gene (e.g., tcpA, tcpB, or tcpR) is amplified by PCR from Vibrio cholerae genomic DNA.

  • Vector construction: The amplified gene is sub-cloned into an expression vector such as pGEX4T1, which contains a GST (Glutathione S-transferase) tag to facilitate purification .

  • Host transformation: The recombinant plasmid is transformed into a suitable E. coli expression strain, commonly BL21(DE3) .

  • Protein expression: Expression is induced using IPTG (Isopropyl β-D-1-thiogalactopyranoside) when cultures reach the appropriate density.

  • Cell lysis: Bacterial cells are harvested and lysed to release the recombinant protein.

  • Affinity purification: The GST-tagged protein is purified using GST resin in affinity chromatography .

  • Tag removal (optional): The GST tag can be cleaved using a site-specific protease if present in the construct.

  • Quality control: The purified protein is analyzed by SDS-PAGE and Western blotting to confirm its identity and purity .

Using this approach, researchers have reported yields of approximately 8 mg of purified recombinant protein per liter of initial culture for TcpA .

How should I design experiments to investigate the structural properties of recombinant tcpR?

When designing experiments to investigate the structural properties of recombinant tcpR, consider implementing the following methodological approach:

  • Expression optimization: Test multiple expression conditions (temperature, IPTG concentration, induction time) to maximize the yield of soluble protein.

  • Structural analysis techniques:

    • X-ray crystallography: For high-resolution structural determination

    • Circular dichroism (CD): To analyze secondary structure elements

    • Nuclear magnetic resonance (NMR): For solution structure and dynamics

    • Cryo-electron microscopy: Especially valuable if tcpR forms part of larger complexes

  • Protein stability assessments:

    • Differential scanning fluorimetry (DSF) to determine thermal stability

    • Limited proteolysis to identify structured domains

  • Interaction studies:

    • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to study binding with other pilus components

    • Pull-down assays to identify protein-protein interactions

  • Experimental controls:

    • Include well-characterized TCP proteins (like TcpA) as positive controls

    • Test the impact of the purification tag on protein structure and function

    • Compare wild-type and mutant variants to identify critical structural elements

For crystallization specifically, implement sparse matrix screening followed by optimization of promising conditions, considering the use of both N-terminal and C-terminal constructs to improve crystallization properties.

What approaches can be used to study the interaction between tcpR and other TCP components?

To systematically study interactions between tcpR and other TCP components, employ the following methodological approaches:

  • In vitro binding assays:

    • Pull-down assays using GST-tagged tcpR to identify interacting partners

    • ELISA-based interaction studies for quantitative binding measurements

    • Surface plasmon resonance (SPR) for real-time binding kinetics and affinity measurements

  • Structural studies of complexes:

    • Co-crystallization of tcpR with potential binding partners

    • Cross-linking followed by mass spectrometry to map interaction sites

    • Hydrogen-deuterium exchange mass spectrometry to identify binding interfaces

  • In vivo interaction studies:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Fluorescence resonance energy transfer (FRET) with fluorescently tagged proteins

    • Co-immunoprecipitation from V. cholerae lysates

  • Genetic approaches:

    • Suppressor mutation analysis to identify functional interactions

    • Site-directed mutagenesis to map critical residues for interactions

    • Complementation studies in tcpR deletion mutants

  • Computational methods:

    • Molecular docking to predict interaction interfaces

    • Molecular dynamics simulations to study the dynamics of interactions

The approach used by researchers studying TcpB-pIII interactions provides a useful model, as they demonstrated direct binding between purified proteins and correlated structural features with functional outcomes in phage uptake .

How can I determine if my recombinant tcpR protein is functionally active?

To assess the functional activity of recombinant tcpR, implement the following methodological workflow:

  • Complementation assays:

    • Generate a tcpR deletion mutant in V. cholerae

    • Introduce plasmid-encoded recombinant tcpR

    • Assess restoration of TCP-dependent phenotypes (colonization, phage uptake, microcolony formation)

  • Biochemical activity tests:

    • If tcpR has predicted enzymatic activity (e.g., ATPase), perform specific enzyme assays

    • For proteins involved in pilus assembly, assess polymerization using in vitro reconstitution systems

  • Binding assays:

    • Test binding to known TCP components using methods like ELISA, SPR, or pull-down assays

    • Assess binding to CTXφ components if tcpR potentially functions in phage uptake

  • Structural integrity confirmation:

    • Circular dichroism to confirm proper folding

    • Size-exclusion chromatography to verify oligomeric state

    • Limited proteolysis to assess domain stability

  • Immunological reactivity:

    • Western blot analysis using antibodies against native tcpR

    • Testing recognition by patient sera to confirm antigenic properties

  • Functional comparison table:

Functional PropertyWild-type tcpRRecombinant tcpRNegative Control
Pilus assembly++++To be determined-
Phage uptake++++To be determined-
Protein-protein interactions++++To be determined-
Antibody recognition++++To be determined-

This systematic approach will provide multiple lines of evidence regarding the functional integrity of your recombinant tcpR protein.

How can I develop an optimal experimental design for studying tcpR function in a large dataset?

When developing an experimental design for studying tcpR function using large datasets, implement the following methodological approach based on principles of optimal experimental design:

  • Initial learning phase:

    • Extract a random subset (n ≈ 5,000) from your full dataset to gain prior information

    • Develop preliminary models and parameter estimates from this subset

    • Use maximum likelihood estimation (MLE) to determine parameters and standard errors

  • Sequential design process:

    • Implement Sequential Monte Carlo (SMC) algorithms to approximate target distributions as data are collected

    • Use utility functions that prioritize precise estimation of model parameters

    • Employ optimization procedures (such as grid search) to identify optimal design points

  • Covariate structure considerations:

    • Account for correlation structures between variables in your experimental design

    • Be aware that negative correlations may require larger sample sizes (see table below)

Covariance StructureParameter EstimatesObserved Utility
No correlation(-1.11, 0.33, 0.11)18.9
Positive correlation(-0.91, 0.27, 0.13)19.3
Negative correlation(-1.04, 0.31, 0.15)17.3
  • Sample size optimization:

    • Compare designed subsets with random samples of varying sizes

    • Determine the "sample size savings" achieved through principled design

    • For most correlation structures, random samples would need to be 1.5-2× larger to achieve similar utility to optimally designed samples

  • Validation approach:

    • Verify that parameter estimates from designed subsets approximate those from the full dataset

    • Compare computational efficiency between designed approach and random sampling

    • Evaluate the coverage of design space by selected data points

This optimized experimental design methodology will maximize the information gained while minimizing the computational burden associated with analyzing the full dataset.

What are the challenges in resolving the structure-function relationship of tcpR in the TCP biogenesis pathway?

Resolving the structure-function relationship of tcpR in the TCP biogenesis pathway presents several methodological challenges that require systematic approaches:

  • Membrane association challenges:

    • Like many TCP components, tcpR likely associates with membranes, complicating structural studies

    • Solution: Use detergent screening, nanodiscs, or amphipols to maintain native conformation during purification and analysis

    • Implement computational prediction to identify transmembrane regions that might require special handling

  • Functional redundancy:

    • TCP biogenesis involves multiple proteins with potentially overlapping functions

    • Solution: Create combinatorial deletion mutants to isolate tcpR-specific effects

    • Use complementation with chimeric proteins to map functional domains

  • Dynamic protein interactions:

    • TCP assembly is a dynamic process with transient interactions

    • Solution: Implement crosslinking strategies to capture transient complexes

    • Use time-resolved structural methods (such as time-resolved cryo-EM) to capture assembly intermediates

  • Technical limitations in visualization:

    • TCP filaments are thin (8.5 nm) structures that can be challenging to visualize

    • Solution: Implement cryo-electron tomography for in situ visualization

    • Use super-resolution fluorescence microscopy with tagged tcpR to track localization during biogenesis

  • Correlating in vitro and in vivo findings:

    • In vitro biochemical properties may not fully reflect in vivo function

    • Solution: Develop assays that bridge in vitro and in vivo contexts

    • Use site-specific in vivo crosslinking to validate interaction sites identified in vitro

Researchers working with TcpB have successfully addressed some of these challenges by correlating structural data with functional outcomes in phage uptake assays, providing a methodological template for tcpR studies .

How can I design a recombinant tcpR protein for potential vaccine development?

To design a recombinant tcpR protein as a vaccine candidate, implement the following methodological approach based on successful strategies with other TCP components:

  • Antigen design considerations:

    • Identify conserved epitopes across V. cholerae strains using bioinformatic analysis

    • Focus on surface-exposed regions of tcpR that are likely to be immunogenic

    • Consider fusion constructs with known immunostimulatory proteins

    • Evaluate potential for cross-protection against multiple V. cholerae serotypes

  • Expression system optimization:

    • Test multiple expression vectors (e.g., pGEX4T1 used successfully for TcpA)

    • Optimize codon usage for expression host

    • Evaluate the impact of affinity tags on immunogenicity

    • Compare prokaryotic (E. coli) vs. eukaryotic expression systems

  • Purification and quality control:

    • Implement affinity chromatography (GST resin for GST-tagged constructs)

    • Perform endotoxin removal for vaccine applications

    • Conduct thorough quality assessment:

      • Western blotting with anti-V. cholerae antibodies

      • Mass spectrometry to confirm protein identity

      • Circular dichroism to verify proper folding

  • Immunogenicity assessment protocol:

    • Test reactivity with sera from cholera patients

    • Compare recognition by immunized animal sera and human patient sera

    • Evaluate cross-reactivity with other bacterial antigens to assess specificity

  • Candidate evaluation framework:

Evaluation CriteriaAssessment MethodThreshold for Advancement
Expression yieldQuantitative protein assay>5 mg/L culture
PuritySDS-PAGE analysis>95%
AntigenicityWestern blot with patient seraPositive recognition
StabilityAccelerated stability testing<10% degradation at 4°C after 6 months
ImmunogenicityELISA titers in animal modelsComparable to TcpA controls

As demonstrated with TcpA, this approach can yield approximately 8 mg/L of purified recombinant protein with preserved antigenic properties recognized by both animal sera and patient samples .

How can I address poor solubility of recombinant tcpR protein?

To systematically address poor solubility of recombinant tcpR protein, implement the following methodological troubleshooting approach:

  • Expression condition optimization:

    • Reduce expression temperature (test 18°C, 25°C, and 30°C)

    • Lower IPTG concentration (0.1-0.5 mM range)

    • Test auto-induction media as an alternative to IPTG induction

    • Implement short induction periods (2-4 hours)

  • Construct modification strategies:

    • Design truncated constructs to remove hydrophobic regions

    • Test multiple fusion tags (MBP, SUMO, or thioredoxin) known to enhance solubility

    • Introduce solubility-enhancing mutations based on computational prediction

    • Create chimeric constructs with soluble homologous proteins

  • Co-expression approaches:

    • Co-express with chaperones (GroEL/ES, DnaK/J)

    • Include other TCP components that might form soluble complexes with tcpR

    • Co-express with binding partners identified in interaction studies

  • Solubilization methods:

    • Screen detergents (non-ionic, zwitterionic, and mild ionic)

    • Test solubility enhancers (arginine, proline, sorbitol)

    • Optimize buffer conditions (pH, salt concentration, additives)

    • Consider on-column refolding during purification

  • Alternative approaches if solubility cannot be achieved:

    • Express as inclusion bodies followed by refolding

    • Use cell-free expression systems

    • Implement in situ analysis methods that don't require soluble protein

Document changes in solubility using quantitative measurements (percentage of total protein in soluble fraction) to objectively track improvements across optimization experiments.

How should I interpret seemingly contradictory data about tcpR function in different experimental systems?

When faced with contradictory data about tcpR function across different experimental systems, implement this systematic resolution approach:

  • System-specific variable analysis:

    • Create a comprehensive table comparing all experimental variables across systems:

      • Expression hosts (E. coli strains vs. V. cholerae)

      • Growth conditions (media, temperature, aeration)

      • Protein constructs (tags, truncations, mutations)

      • Assay conditions (buffer composition, temperature, pH)

    • Identify variables that correlate with functional differences

  • Biological context considerations:

    • Evaluate whether the protein functions in isolation or requires partners

    • Assess if post-translational modifications present in V. cholerae are absent in E. coli

    • Consider potential differences in membrane composition affecting function

    • Examine if the protein behaves differently in vitro versus in vivo

  • Methodological reconciliation strategy:

    • Design bridging experiments that systematically vary one condition at a time

    • Implement orthogonal techniques to measure the same functional property

    • Use mutation analysis to identify residues critical across all systems

    • Develop in vitro reconstitution systems that more closely mimic the native environment

  • Statistical analysis of variability:

    • Apply appropriate statistical tests to determine if differences are significant

    • Use power analysis to ensure adequate sample sizes for reliable comparisons

    • Implement Bayesian analysis to integrate prior knowledge with current data

    • Perform sensitivity analysis to identify variables with greatest impact

  • Biological model refinement:

    • Propose a unified model that accounts for system-specific differences

    • Test predictions of the refined model with targeted experiments

    • Consider if tcpR might have multiple functions depending on context

This structured approach transforms apparently contradictory data into a more nuanced understanding of context-dependent tcpR function.

What statistical approaches are most appropriate for analyzing the immunogenicity of recombinant tcpR?

For analyzing the immunogenicity of recombinant tcpR, implement the following statistical methodology:

  • Experimental design considerations:

    • Power analysis to determine appropriate sample sizes

    • Randomized block design to control for animal-to-animal variability

    • Include positive controls (established immunogens like TcpA) and negative controls

    • Account for correlation structures in measurements using appropriate design principles

  • Primary analysis approach:

    • For antibody titers: Log-transform data and apply ANOVA or mixed-effects models

    • For multiple time points: Repeated measures ANOVA or linear mixed models

    • For multiple treatment groups: Adjust for multiple comparisons (Bonferroni, Tukey-HSD)

    • For non-normally distributed data: Non-parametric alternatives (Kruskal-Wallis)

  • Advanced statistical methods:

    • Principal component analysis to identify patterns in immune responses

    • Cluster analysis to identify responder vs. non-responder groups

    • Bayesian approaches to incorporate prior knowledge about related antigens

    • Regression models to identify factors influencing immunogenicity

  • Correlation analysis:

    • Calculate correlations between antibody titers and protection in challenge models

    • Assess cross-reactivity with other V. cholerae antigens

    • Analyze correlations between structural features and immunogenicity

  • Data visualization approach:

    • Use box plots with individual data points for titer data

    • Implement heat maps for epitope mapping results

    • Create scatter plots with regression lines for correlation analyses

    • Use radar charts to compare multiple immunological parameters across groups

This comprehensive statistical approach will provide robust analysis of immunogenicity data while accounting for biological variability and experimental design factors.

What are the most promising approaches for studying the role of tcpR in CTXφ phage uptake?

Based on current understanding of TCP proteins in phage uptake, the following methodological approaches would be most promising for investigating tcpR's potential role:

  • Genetic approach:

    • Generate precise tcpR deletion and point mutants in V. cholerae

    • Quantify CTXφ infection efficiency using phage transduction assays

    • Compare with known phage uptake mutants (like TcpB-E5V) to establish relative importance

    • Implement complementation studies with wild-type and mutant tcpR variants

  • Direct binding assays:

    • Express and purify recombinant tcpR and CTXφ components (especially pIII)

    • Perform in vitro binding studies using techniques like:

      • Surface plasmon resonance for kinetic measurements

      • Pull-down assays for qualitative binding assessment

      • ELISA-based binding assays for quantitative comparisons

    • Compare binding properties with TcpB, which has established interactions with pIII

  • Structural biology approach:

    • Determine the structure of tcpR alone and in complex with phage components

    • Compare with TcpB structure to identify potential shared binding interfaces

    • Use structure-guided mutagenesis to validate functional predictions

    • Implement molecular dynamics simulations to study interaction dynamics

  • Real-time visualization:

    • Develop fluorescently tagged CTXφ to visualize phage uptake in real-time

    • Use super-resolution microscopy to track tcpR localization during infection

    • Implement single-molecule approaches to study the dynamics of phage-pilus interactions

    • Correlate structural changes in tcpR with functional outcomes in phage uptake

  • In situ analysis:

    • Use cryo-electron tomography to visualize phage-pilus interactions in near-native state

    • Apply proximity labeling approaches to identify proteins near tcpR during phage uptake

    • Implement crosslinking strategies to capture transient interaction complexes

This multi-faceted approach will provide comprehensive insights into tcpR's potential role in phage uptake, building on established methodologies used successfully with TcpB .

How might tcpR interact with other TCP components in the biogenesis pathway?

To systematically investigate tcpR interactions with other TCP components, implement the following research methodology:

  • Comprehensive interaction screening:

    • Perform bacterial two-hybrid or split-GFP assays to screen all TCP components

    • Implement co-immunoprecipitation with tagged tcpR from V. cholerae membranes

    • Use crosslinking mass spectrometry to identify proximity relationships

    • Apply BioID or APEX2 proximity labeling to identify neighboring proteins in vivo

  • Temporal interaction mapping:

    • Develop inducible expression systems to control TCP biogenesis initiation

    • Use time-resolved crosslinking to capture assembly intermediates

    • Implement pulse-chase approaches to track protein complex formation

    • Create synchronization protocols to study assembly sequence

  • Structural characterization of complexes:

    • Purify stable sub-complexes containing tcpR for structural studies

    • Use negative-stain and cryo-EM to visualize larger assemblies

    • Perform hydrogen-deuterium exchange mass spectrometry to map binding interfaces

    • Implement integrative structural biology combining multiple data types

  • Functional validation of interactions:

    • Design interface mutations based on structural data

    • Test effects on pilus assembly, stability, and function

    • Perform suppressor mutation analysis to identify compensatory changes

    • Develop reconstitution systems to test minimal component requirements

  • Interaction network analysis:

    • Construct a comprehensive interaction network for TCP biogenesis

    • Identify critical nodes and potential regulatory points

    • Compare with homologous type IV pilus systems for evolutionary insights

    • Use the network to predict functional consequences of mutations

This systematic approach will provide a detailed map of tcpR's position and function within the TCP biogenesis pathway, potentially revealing new therapeutic targets for cholera treatment.

What are the key considerations for developing a multivalent vaccine that includes tcpR along with other Vibrio cholerae antigens?

For developing a multivalent vaccine incorporating tcpR alongside other V. cholerae antigens, implement this comprehensive methodological framework:

  • Antigen selection criteria:

    • Evaluate conservation across V. cholerae strains (bioinformatic analysis)

    • Assess immunogenicity in natural infection (analyze patient sera)

    • Consider functional importance (target virulence factors like TCP components)

    • Evaluate potential for synergistic protection

    • Include complementary antigens that stimulate different arms of immunity

  • Combination strategy development:

    • Design fusion proteins versus co-administration

    • Determine optimal antigen ratios through dose-response studies

    • Evaluate potential for antigenic competition

    • Consider temporal sequence of immune responses

  • Formulation optimization:

    • Screen adjuvants for enhanced immunogenicity

    • Develop delivery systems (nanoparticles, liposomes) for mucosal immunity

    • Optimize stability of multivalent formulations

    • Address thermostability for potential use in cholera-endemic regions

  • Immunological assessment protocol:

    • Measure antibody responses to individual components

    • Evaluate functional antibodies (e.g., vibriocidal activity)

    • Assess cellular immune responses

    • Test cross-protection against multiple V. cholerae strains

  • Integration with previous findings:

    • Evidence suggests that solid protective immunity requires multiple antigens rather than single proteins

    • Similar findings from malaria and leprosy models support multivalent approach

    • The recombinant TcpA approach provides a methodological template for tcpR

  • Comparative evaluation framework:

Vaccine FormulationAntibody ResponseProtection in Challenge ModelsManufacturing FeasibilityStability
tcpR aloneTo be determinedTo be determinedHigh (similar to TcpA)To be determined
TcpA aloneStrongPartialDemonstratedGood
tcpR + TcpATo be determinedTo be determinedHighTo be determined
tcpR + TcpA + CTBTo be determinedTo be determinedModerateTo be determined

This methodical approach acknowledges that effective cholera vaccines likely require multiple antigens working in concert, as observed in other infectious disease models .

What are the most important quality control parameters for recombinant tcpR protein production?

For ensuring consistent quality in recombinant tcpR production, implement this comprehensive quality control framework:

  • Identity confirmation:

    • Western blot analysis using specific antibodies against tcpR

    • Mass spectrometry for accurate molecular weight determination

    • N-terminal sequencing to confirm correct processing

    • Peptide mapping to verify complete sequence coverage

  • Purity assessment:

    • SDS-PAGE with densitometry (target >95% purity)

    • Size exclusion chromatography to detect aggregates

    • Endotoxin testing (crucial for vaccine applications)

    • Host cell protein assays using sensitive ELISA methods

  • Structural integrity verification:

    • Circular dichroism to confirm secondary structure

    • Fluorescence spectroscopy to assess tertiary structure

    • Dynamic light scattering to evaluate homogeneity

    • Limited proteolysis to verify domain organization

  • Functional validation:

    • Binding assays with known interaction partners

    • Enzymatic activity tests if applicable

    • Comparison with reference standard in functional assays

    • Immunological recognition by cholera patient sera

  • Stability monitoring:

    • Accelerated and real-time stability studies

    • Freeze-thaw stability assessment

    • pH and temperature stress testing

    • Long-term storage condition optimization

  • Batch consistency parameters:

    • Yield (target >5-8 mg/L based on TcpA results)

    • Consistent binding affinity to interaction partners

    • Reproducible recognition by standard antibodies

    • Uniform appearance and solubility properties

This systematic quality control approach ensures that recombinant tcpR preparations maintain consistent properties essential for reliable research findings and potential vaccine development applications.

How can I design experiments to resolve contradictions in the literature about TCP protein functions?

To systematically resolve contradictions in the literature regarding TCP protein functions, implement this methodological framework:

  • Experimental variable standardization:

    • Create a comprehensive table of experimental conditions across conflicting studies

    • Identify key variables that differ between studies (strain backgrounds, growth conditions, assay methods)

    • Design experiments that systematically test each variable's impact on outcomes

    • Implement factorial designs to test variable interactions efficiently

  • Strain validation protocol:

    • Sequence-verify all bacterial strains used

    • Confirm phenotypes of reference strains match published characteristics

    • Create isogenic strains differing only in the variable of interest

    • Include well-characterized control strains in all experiments

  • Methodological reconciliation approach:

    • Replicate conflicting methods side-by-side in the same laboratory

    • Implement multiple orthogonal techniques to measure the same parameter

    • Develop standardized protocols with explicit controls

    • Perform blinded analyses to prevent observer bias

  • Statistical robustness measures:

    • Conduct power analyses to ensure adequate sample sizes

    • Implement appropriate statistical tests based on data distribution

    • Use meta-analysis approaches to integrate results across studies

    • Report effect sizes alongside statistical significance

  • Collaborative resolution strategy:

    • Organize multi-laboratory validation studies for key findings

    • Exchange materials between laboratories reporting conflicting results

    • Develop consensus reporting standards for TCP function assays

    • Establish repositories for validated strains and protocols

This systematic approach transforms contradictions into research opportunities that can ultimately provide a more nuanced understanding of TCP protein functions across different experimental contexts.

What methodological approaches would best integrate structural, functional, and immunological data on tcpR?

To optimally integrate structural, functional, and immunological data on tcpR, implement this comprehensive methodological framework:

  • Structure-function correlation strategy:

    • Map functional data onto structural models using visualization tools

    • Generate structure-based hypotheses and test with targeted mutations

    • Identify structural epitopes and correlate with immunological data

    • Use molecular dynamics simulations to connect static structures with dynamic functions

  • Integrated database development:

    • Create a unified database incorporating diverse data types

    • Implement consistent annotation standards across data types

    • Develop visualization tools for multi-dimensional data exploration

    • Enable statistical analysis across integrated datasets

  • Machine learning approach:

    • Train predictive models using integrated datasets

    • Identify patterns not obvious through conventional analysis

    • Validate predictions with targeted experiments

    • Refine models iteratively with new experimental data

  • Systems biology framework:

    • Position tcpR within the broader TCP biogenesis network

    • Create mathematical models of TCP assembly incorporating structural constraints

    • Predict system-level consequences of tcpR perturbations

    • Design minimal systems that recapitulate key functions

  • Translational integration methodology:

    • Connect basic research findings to vaccine development

    • Design structure-based immunogens targeting protective epitopes

    • Use functional data to prioritize antigen candidates

    • Implement rational optimization based on integrated data

  • Implementation workflow:

Data TypeKey MethodsIntegration ApproachValidation Strategy
StructuralX-ray crystallography, Cryo-EMStructure-guided mutagenesisFunctional assays
FunctionalPhage uptake assays, Pilus assemblyStructure-function mappingIn vivo models
ImmunologicalEpitope mapping, Antibody profilingStructure-based epitope predictionProtection studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.