Recombinant Vibrio cholerae serotype O1 Type II secretion system protein F (epsF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
epsF; VC_2731; Type II secretion system protein F; T2SS protein F; Cholera toxin secretion protein EpsF; General secretion pathway protein F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-406
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Target Names
epsF
Target Protein Sequence
MAAFEYKALDAKGRHKKGVIEGDNARQVRQRLKEQSLVPMEVVETQVKAARSRSQGFAFK RGISTPDLALITRQLATLVQSGMPLEECLRAVAEQSEKPRIRTMLVAVRAKVTEGYTLSD SLGDYPHVFDELFRSMVAAGEKSGHLDSVLERLADYAENRQKMRSKLQQAMIYPVVLVVF AVGIVAFLLAAVVPKIVGQFVQMGQALPASTQFLLDASDFLQHWGISLLVGLLMLIYLVR WLLTKPDIRLRWDRRVISLPVIGKIARGLNTARFARTLSICTSSAIPILDGMRVAVDVMT NQFVKQQVLAAAENVREGSSLRKALEQTKLFPPMMLHMIASGEQSGELEGMLTRAADNQD NSFESTVNIALGIFTPALIALMAGMVLFIVMATLMPILEMNNLMSR
Uniprot No.

Target Background

Function
A component of the type II secretion system's inner membrane complex. It is essential for the energy-dependent secretion of extracellular factors (e.g., proteases and toxins) from the bacterial periplasm.
Database Links

KEGG: vch:VC2731

STRING: 243277.VC2731

Protein Families
GSP F family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of epsF within the Type II Secretion System of Vibrio cholerae?

EpsF is an essential component of the General Secretion Pathway (GSP) in Vibrio cholerae, functioning as part of a multiprotein complex that facilitates the secretion of various proteins through the outer membrane . This complex machinery, encoded by the eps genes (epsC to epsN), is responsible for the translocation of soluble proteins including chitinase, enterotoxin, and proteases . Research has demonstrated that epsF specifically encodes a protein that is critical for proper GSP function, as mutations in this gene result in compromised secretion capabilities . The EpsF protein is believed to work in concert with other Eps proteins to form a functional secretory apparatus spanning both the inner and outer bacterial membranes.

How does the Type II Secretion System contribute to V. cholerae pathogenesis?

The Type II Secretion System, including EpsF, plays a multifaceted role in V. cholerae pathogenesis by facilitating the secretion of key virulence factors. Most notably, the T2SS coordinates the outer membrane translocation of cholera toxin, the primary virulence factor responsible for the severe diarrhea characteristic of cholera . Additionally, the system mediates the secretion of other virulence-associated proteins such as hemagglutinin/protease, lipases, and various proteases that contribute to colonization and survival within the host . Experimental evidence indicates that mutations in eps genes can reduce cholera toxin secretion, thereby directly impacting virulence potential . Furthermore, the T2SS has been implicated in environmental survival mechanisms, including the production of rugose polysaccharide, which enhances biofilm formation and resistance to various environmental stressors .

What are the structural characteristics of EpsF protein?

While the search results don't provide specific structural details about EpsF, it can be inferred from studies of the T2SS in V. cholerae that EpsF likely shares structural motifs with homologous proteins in related bacterial species such as Aeromonas, Erwinia, Klebsiella, Pseudomonas, and Xanthomonas . Methodologically, researchers investigating EpsF structure typically employ a combination of:

  • Sequence alignment analysis to identify conserved domains

  • Structural prediction algorithms to model secondary and tertiary structures

  • Protein crystallography or cryo-electron microscopy for detailed structural determination

  • Protein-protein interaction studies to understand functional domains

These approaches collectively provide insights into the structural features that underpin EpsF function within the larger T2SS complex.

What are the optimal conditions for expressing recombinant V. cholerae epsF in heterologous systems?

Based on experimental approaches described in the literature, recombinant expression of EpsF typically follows these methodological guidelines:

Expression System Selection:

  • E. coli BL21(DE3) or similar strains are preferred for recombinant EpsF expression due to their reduced protease activity and compatibility with T7 promoter-based expression systems .

  • Vibrio-specific expression factors should be considered, as heterologous expression may require codon optimization.

Expression Vector and Conditions:

  • Vectors containing inducible promoters (T7, arabinose, or tetracycline-responsive) allow controlled expression.

  • Expression temperature optimization is critical (typically 16-30°C), as lower temperatures often improve proper folding of membrane or membrane-associated proteins.

  • Induction conditions should be empirically determined, with IPTG concentrations typically ranging from 0.1 to 1.0 mM for T7-based systems.

Protein Extraction and Purification Strategy:
The following table outlines a recommended purification protocol based on research methodologies:

StepProcedureBuffer CompositionNotes
1Cell lysis50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, protease inhibitorsSonication or pressure-based disruption
2Membrane fraction isolationSame as lysis buffer + 0.1 mM DTTUltracentrifugation (100,000 × g, 1h)
3Membrane protein solubilizationAbove buffer + 1-2% detergent (DDM, LDAO, or Triton X-100)Gentle agitation, 4°C, 1-2 hours
4Affinity chromatography50 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.05% detergentFor His-tagged constructs
5Size exclusion chromatography25 mM Tris-HCl pH 7.5, 100 mM NaCl, 0.02% detergentFinal polishing step

Validation experiments using SDS-PAGE, Western blotting, and mass spectrometry are essential to confirm the identity and purity of recombinant EpsF.

How can researchers generate and validate epsF mutants in V. cholerae?

Creating and validating epsF mutants requires a systematic approach:

Generation of Defined Mutations:

  • Construct allelic exchange vectors containing the epsF gene with desired mutations flanked by homologous regions .

  • Incorporate counterselectable markers (such as sacB) to facilitate selection of double-crossover events .

  • Introduce the construct into V. cholerae through conjugation using appropriate donor strains (e.g., E. coli SM10 λpir) .

  • Select for double-crossover recombinants using antibiotic resistance markers and counterselection (often sucrose sensitivity).

Validation Methods:

  • PCR verification of the mutant allele integration.

  • Sequencing to confirm the exact mutation introduced.

  • Western blot analysis to verify changes in protein expression or processing.

  • Functional assays to assess impact on secretion (described in FAQ 2.3).

For complementation studies, researchers should clone the wild-type epsF gene into an appropriate Vibrio expression vector and introduce it into the mutant strain to confirm phenotype restoration, thus validating the specificity of the mutant phenotype.

What assays can be used to measure T2SS function and specifically assess epsF activity?

Several complementary assays provide insights into T2SS function and epsF contribution:

Protein Secretion Assays:

  • Cholera Toxin Quantification: ELISA-based quantification of CT in culture supernatants provides a direct measure of T2SS function .

  • Enzymatic Activity Assays: Measuring activities of secreted enzymes such as:

    • Protease activity using azocasein or similar substrates

    • Chitinase activity using fluorogenic substrates

    • Lipase activity using tributyrin or p-nitrophenyl palmitate

Membrane Integrity and Composition Analysis:

  • Outer membrane protein profiling via SDS-PAGE and mass spectrometry, as mutations in eps genes result in aberrant outer membrane protein profiles .

Biofilm and Rugose Polysaccharide Assessment:

  • Crystal violet staining for biofilm quantification.

  • Colony morphology analysis on appropriate media to assess rugose phenotype .

Microscopy-Based Approaches:

  • Fluorescent protein fusion analysis to observe localization patterns of EpsF and its interaction partners, similar to studies with EpsC and EpsM .

  • Transmission electron microscopy to visualize secretion apparatus structures.

When specifically investigating EpsF function, researchers should compare wild-type, epsF mutant, and complemented strains across these assays to delineate EpsF's specific contribution to the T2SS functionality.

How do protein-protein interactions involving EpsF contribute to T2SS assembly and function?

Understanding EpsF's protein-protein interactions requires sophisticated experimental approaches:

Key Methodological Approaches:

  • Bacterial Two-Hybrid Analysis: This system can detect in vivo protein-protein interactions by fusing proteins of interest to complementary fragments of adenylate cyclase or similar reporter systems.

  • Co-immunoprecipitation Studies: Using antibodies against EpsF or epitope-tagged versions to identify interacting partners.

  • Crosslinking Coupled with Mass Spectrometry: Chemical crosslinking captures transient interactions, with subsequent MS analysis identifying interaction sites.

  • Fluorescence Microscopy with Co-localization Analysis: Similar to studies with EpsC and EpsM, fluorescently tagged EpsF can reveal dynamic assembly patterns and dependencies .

Research findings suggest that proper T2SS assembly requires coordinated interactions between multiple Eps proteins. For example, deletion of epsD causes dispersion of fluorescent foci in strains expressing GFP-EpsC and GFP-EpsM, indicating that EpsD is critical for localizing these components . By extension, EpsF likely participates in similar interaction networks, potentially forming crucial connections within the secretion apparatus.

Advanced structural studies utilizing cryo-electron microscopy or X-ray crystallography of EpsF in complex with interaction partners would provide the most detailed insights into these molecular interfaces.

What is the relationship between EpsF and the processing of secreted proteins in V. cholerae?

The relationship between EpsF and protein processing involves multiple layers:

  • Direct vs. Indirect Effects: While EpsF is essential for T2SS function , whether it directly participates in substrate recognition or processing remains an open research question. Experiments comparing protein processing in wild-type vs. epsF mutant strains can help delineate direct from indirect effects.

  • Potential Processing Mechanisms: Some T2SS components may interact with processing enzymes such as prepilin peptidases. For example, EpsG (another T2SS component) appears to undergo processing similar to pilin proteins . Researchers investigating EpsF's role in processing should consider:

    • Protein secretion assays using reporter constructs with processing-dependent activity

    • In vitro processing assays with purified components

    • Proteomic analysis of secreted protein profiles in wild-type vs. mutant strains

  • Methodological Considerations: Advanced mass spectrometry techniques such as N-terminal sequencing or bottom-up proteomics can identify specific processing events that may depend on functional EpsF.

How does environmental regulation affect epsF expression and function?

Environmental regulation of epsF expression represents a complex interplay of factors:

Environmental Signals and Regulatory Mechanisms:
While the search results don't specifically address epsF regulation, the T2SS in V. cholerae responds to multiple environmental cues relevant to both pathogenesis and environmental survival. Researchers investigating environmental regulation should:

  • Assess Transcriptional Regulation:

    • Utilize reporter gene fusions (epsF promoter fused to lacZ, gfp, or luciferase)

    • Perform qRT-PCR analysis under varying conditions (pH, osmolarity, temperature, nutrient availability)

    • Conduct chromatin immunoprecipitation (ChIP) to identify transcription factors binding the epsF promoter

  • Analyze Post-transcriptional Regulation:

    • Investigate RNA stability under different conditions

    • Examine potential small RNA regulators using computational prediction followed by validation experiments

  • Study Post-translational Regulation:

    • Assess protein stability and modification under various conditions

    • Investigate potential regulatory protein-protein interactions

Data Table: Hypothetical Environmental Conditions for Testing epsF Regulation

Environmental FactorTest ConditionsPotential ImpactAssessment Method
pH5.5, 7.0, 8.5Altered expression/function in intestinal vs. environmental pHqRT-PCR, Western blot, secretion assays
Osmolarity0, 100, 300 mM NaClChanged regulation in fresh vs. saltwaterReporter assays, protein localization
Temperature25°C, 30°C, 37°CDifferential expression in environment vs. hostTranscriptomics, protein activity assays
Oxygen availabilityAerobic, microaerobic, anaerobicAdaptation to intestinal conditionsRNA-seq, proteomics
Carbon sourceGlucose, chitin, mucinNutrient-dependent regulationMetabolomics, secretion profiling

What are the common challenges in expressing and purifying functional recombinant EpsF protein?

Researchers frequently encounter several challenges when working with recombinant EpsF:

Expression Challenges and Solutions:

  • Protein Solubility: As a component of a membrane-associated secretion system, EpsF may present solubility issues.

    • Solution: Use specialized solubility tags (MBP, SUMO, TrxA) or optimize detergent conditions for extraction.

  • Protein Stability: T2SS components can be prone to degradation.

    • Solution: Express at lower temperatures (16-20°C), include protease inhibitors throughout purification, and consider fusion partners that enhance stability.

  • Proper Folding: Obtaining correctly folded EpsF is essential for functional studies.

    • Solution: Consider expression in specialized strains containing additional chaperones or co-expression with natural interaction partners.

  • Low Expression Yields: Membrane or membrane-associated proteins often express poorly.

    • Solution: Optimize codon usage, use strong but controllable promoters, and consider testing multiple expression strains.

Purification Troubleshooting:

  • Co-purifying Contaminants: Interaction partners or proteolytic fragments may co-purify.

    • Solution: Implement multiple orthogonal purification steps and validate protein identity via mass spectrometry.

  • Aggregation During Concentration: Common with membrane proteins.

    • Solution: Add glycerol (5-10%), use appropriate detergents at CMC levels, and avoid excessive concentration.

  • Loss of Function During Purification: Activity may diminish during purification steps.

    • Solution: Validate function at each step using appropriate activity assays and minimize time between purification steps.

How can researchers address issues with phenotypic complementation in epsF mutant strains?

When complementation of epsF mutants fails to restore wild-type phenotypes, consider these methodological approaches:

  • Expression Level Considerations:

    • Chromosomal integration at native locus often provides the most physiologically relevant expression levels .

    • Plasmid-based complementation may result in over- or under-expression.

    • Solution: Use inducible promoters with titratable expression levels to optimize complementation.

  • Polar Effects on Downstream Genes:

    • Mutations in epsF may affect expression of downstream genes in the eps operon.

    • Solution: Design non-polar mutations or complement with the entire affected operon segment.

  • Proper Protein Interactions:

    • EpsF function depends on interactions with other Eps proteins; expression timing and stoichiometry may be critical.

    • Solution: Co-express interacting partners or use dual-plasmid complementation strategies for complex reconstitution.

  • Technical Validation Approaches:

    • Confirm expression of the complementing gene via RT-PCR and Western blotting.

    • Sequence the complementation construct to ensure no unintended mutations.

    • Test multiple independent complementation clones to rule out secondary mutations.

How might structural studies of EpsF contribute to developing novel antimicrobial strategies?

The structural characterization of EpsF holds significant potential for antimicrobial development:

Research Approaches for Structural Determination:

  • X-ray Crystallography: Requires purification of crystallization-quality EpsF protein, potentially in complex with stabilizing partners.

  • Cryo-Electron Microscopy: Increasingly powerful for membrane protein complexes, allowing visualization of EpsF in its native context within the T2SS.

  • NMR Studies: Suitable for determining structures of specific domains or interaction interfaces.

  • In Silico Molecular Modeling: Combining homology modeling with molecular dynamics simulations to predict structure-function relationships.

Therapeutic Applications of Structural Data:

  • Structure-Based Drug Design: Identification of druggable pockets in EpsF that could be targeted to disrupt T2SS function.

  • Peptide Inhibitor Development: Design of peptides that mimic interaction interfaces to competitively inhibit essential protein-protein interactions.

  • Allosteric Modulator Discovery: Identification of sites distant from the active site that could still influence function when targeted.

Since the T2SS is critical for V. cholerae virulence , targeting EpsF or its interactions represents a promising strategy for developing novel antimicrobials with potentially reduced selective pressure compared to conventional antibiotics.

What is the evolutionary significance of the Type II secretion system protein F across different Vibrio species?

Understanding the evolutionary aspects of EpsF requires comparative genomic and functional approaches:

Research Methodologies:

  • Phylogenetic Analysis: Construction of phylogenetic trees based on epsF sequences from diverse Vibrio species and other bacteria with T2SS.

  • Comparative Genomics: Analysis of synteny and gene organization around epsF in different species.

  • Functional Complementation Studies: Testing whether epsF from different species can complement V. cholerae epsF mutants.

  • Selection Pressure Analysis: Calculating dN/dS ratios to identify conserved vs. diversifying regions of the protein.

Evolutionary Insights:
The T2SS components, including EpsF, show similarity across diverse bacterial species including Aeromonas, Erwinia, Klebsiella, Pseudomonas, and Xanthomonas , suggesting ancient evolutionary origins of this secretion system. Targeted research comparing EpsF function across these diverse bacteria could reveal:

  • Core conserved domains essential for basic T2SS function

  • Species-specific adaptations that may reflect niche-specific selective pressures

  • Potential horizontal gene transfer events that shaped T2SS evolution

How might high-throughput screening approaches identify inhibitors of EpsF function?

Developing high-throughput screening (HTS) platforms for EpsF inhibitor discovery requires innovative experimental design:

Screening Assay Development:

  • Fluorescence-Based Interaction Assays:

    • FRET or BRET assays to detect disruption of EpsF interactions with partner proteins

    • Split-GFP complementation assays to monitor protein-protein interactions in real-time

  • Functional Secretion Assays:

    • Reporter enzyme secretion (e.g., alkaline phosphatase fusions) in whole-cell systems

    • Bioluminescence-based detection of secretion efficiency

  • Structural Stability Assays:

    • Thermal shift assays to detect compounds that bind and potentially destabilize EpsF

    • Hydrogen-deuterium exchange mass spectrometry to identify binding sites

Compound Library Considerations:

  • Natural product libraries from marine sources may contain compounds evolved to target bacterial secretion systems

  • Peptidomimetic libraries designed based on interaction interfaces

  • Fragment-based approaches focusing on building blocks that can be elaborated into larger inhibitors

Validation Pipeline:

  • Primary screening in high-throughput format

  • Secondary validation in dose-response assays

  • Tertiary confirmation in V. cholerae infection models

  • Mechanistic studies to confirm EpsF as the target

The development of EpsF inhibitors could lead to novel anti-virulence strategies that specifically target V. cholerae pathogenesis without directly affecting bacterial viability, potentially reducing selection pressure for resistance development.

How does understanding EpsF function contribute to our broader knowledge of bacterial secretion systems?

The study of EpsF within the V. cholerae T2SS provides valuable insights into fundamental principles of bacterial secretion:

  • Conservation vs. Specialization: Comparative studies of EpsF across bacterial species reveal both conserved functional domains and species-specific adaptations, illuminating evolutionary principles governing secretion system development .

  • Structural-Functional Relationships: Investigations into EpsF structure and interactions advance our understanding of how multiprotein complexes assemble across bacterial membranes to create functional conduits .

  • Regulatory Integration: Research on environmental regulation of epsF expression reveals how bacteria coordinate secretion with sensing of host and environmental cues.

  • Systems Biology Perspective: The interdependence of EpsF function with other Eps proteins illustrates the importance of studying protein complexes as integrated systems rather than isolated components .

By expanding our knowledge of EpsF, researchers contribute to a comprehensive understanding of bacterial secretion systems that extends beyond V. cholerae to inform broader concepts in microbial physiology and host-pathogen interactions.

What interdisciplinary approaches could advance our understanding of EpsF function and applications?

The most promising future research on EpsF will likely emerge from interdisciplinary collaborations:

  • Structural Biology + Computational Chemistry: Combining experimental structure determination with molecular dynamics simulations to understand dynamic aspects of EpsF function.

  • Microbiology + Materials Science: Exploring potential biotechnological applications of the T2SS, such as engineered protein secretion systems for industrial enzyme production.

  • Molecular Biology + Synthetic Biology: Designing synthetic T2SS variants with novel specificities by engineering EpsF and partner proteins.

  • Infection Biology + Immunology: Investigating how T2SS-secreted factors modulate host immune responses and how this knowledge might inform vaccine development.

  • Evolutionary Biology + Ecology: Studying how environmental factors shape epsF evolution and function across Vibrio species in different ecological niches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.