Recombinant Vibrio cholerae serotype O1 Type II secretion system protein L (epsL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
epsL; VC_2725; Type II secretion system protein L; T2SS protein L; Cholera toxin secretion protein EpsL; General secretion pathway protein L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-407
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Target Names
epsL
Target Protein Sequence
MEGSVSEFLTVRLSSQKEADIPWLVWSAEQQEVIASGQVAGWEALHEIESYADQRSVVVL LAASDLILTSVEIPPGASRQLENMLPYLLEDEIAQDVEDVHFCVLSKGRETADVVGVDRL WLRACLDHLKACGFDVKRVLPDVLAIPRPEHGLAALQLGDEWLVRKSTTQGMAVDAQWLS LLAASDWVQNEGEYLPLQALTPLPELSLAETQEWRYEPSGLVMQLLTQEALTSKFNLLTG SFKLKSSWLRYWQIWRKVAIAAGLFVAVSISYSLFQAHQYEAQADAYRAESERIFRSIFP DKQKIPTVTYLKRQMSDEMARLSGGASVGSVLKWLSPLPEALKGVNLQLQSIKFDSNRSE IRLEATSRDFQSFEQARTQLEQYFAVEQGQLNKNGEQVFGVFVVKPK
Uniprot No.

Target Background

Function

EpsL is an inner membrane component of the type II secretion system (T2SS). It's essential for the energy-dependent secretion of extracellular factors (e.g., proteases and toxins) from the periplasm. EpsL plays a critical role in the complex assembly of the T2SS, recruiting EpsM to form a stable inner membrane complex. This complex functionally links the cytoplasmic energy-providing EpsE protein to the remaining T2SS machinery.

Database Links

KEGG: vch:VC2725

STRING: 243277.VC2725

Protein Families
GSP L family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the basic structure and function of EpsL in the Type II secretion system?

EpsL is a critical inner membrane component of the Type II secretion (T2S) system in Vibrio cholerae. Structurally, EpsL contains a short cytoplasmic N-terminal domain, a single transmembrane segment, and a larger periplasmic domain. Functionally, EpsL serves as a key structural component that helps anchor the secretion apparatus to the inner membrane while establishing crucial protein-protein interactions with other T2S components .

The T2S system in V. cholerae is composed of 12 Eps proteins (EpsC to EpsN) that assemble into a multiprotein complex spanning the entire cell envelope. Among these, EpsL is particularly important for maintaining the structural integrity of the apparatus through its interactions with other proteins, especially EpsM . The functional T2S system is essential for the secretion of cholera toxin, the major virulence factor responsible for the characteristic watery diarrhea in cholera infections .

How do researchers distinguish between EpsL from different Vibrio species?

Researchers distinguish EpsL proteins from different Vibrio species through several comparative methods. Sequence alignment analysis reveals conserved domains across species, with the highest conservation typically observed in the periplasmic regions involved in protein-protein interactions. Functional complementation studies can be performed by expressing EpsL from different Vibrio species in an epsL deletion mutant to assess restoration of secretion capacity .

Immunological detection using antibodies raised against conserved epitopes can be employed, though species-specific antibodies may be needed for definitive discrimination. Structural predictions based on amino acid sequences help identify potential functional differences in interaction domains. When working with recombinant EpsL, researchers should carefully document the specific strain origin, as even within V. cholerae serotypes, sequence variations may affect protein functionality and interaction capabilities .

What are the essential domains of EpsL for proper Type II secretion system function?

The essential domains of EpsL critical for proper T2S function have been identified through systematic structure-function analyses. The periplasmic domain of EpsL contains regions necessary for interactions with other T2S components, particularly EpsM. Research indicates that specific residues within this domain are indispensable for maintaining stable protein-protein interactions that support the secretion apparatus architecture .

The cytoplasmic domain of EpsL contributes to anchoring the secretion complex to the inner membrane and may interact with cytoplasmic components of the system. The transmembrane domain not only anchors EpsL in the inner membrane but may also participate in conformational changes during the secretion process. Mutation studies have demonstrated that alterations in these domains can disrupt secretion, highlighting their essential nature for T2S functionality .

What are the optimal conditions for recombinant expression of EpsL?

Successful recombinant expression of EpsL requires careful optimization of multiple parameters. Based on systematic studies of recombinant protein expression in E. coli, several factors significantly impact EpsL production:

First, the accessibility of translation initiation sites is crucial, with higher accessibility correlating strongly with improved protein expression. This can be optimized by synonymous codon substitutions in the first nine codons of the EpsL sequence using tools such as TIsigner . The choice of expression vector affects outcomes significantly, with the pET21_NESG vector containing the T7lac inducible promoter showing good results for many difficult-to-express proteins .

Temperature modulation during induction (typically 18-25°C) helps reduce inclusion body formation, while co-expression with chaperones can improve solubility. Addition of fusion tags (particularly solubility-enhancing tags like MBP or SUMO) often improves expression yield. Expression in specialized E. coli strains such as C41(DE3) or C43(DE3), which are designed for membrane protein expression, generally yields better results than standard BL21(DE3) strains .

A comprehensive expression optimization table should include:

ParameterOptimization StrategyEffect on EpsL Expression
mRNA accessibilitySynonymous substitutions in first 9 codonsIncreases translation initiation efficiency
Induction temperature18-25°CReduces inclusion body formation
IPTG concentration0.1-0.5 mMBalances expression level and toxicity
Host strainC41(DE3) or C43(DE3)Better tolerance for membrane proteins
Fusion tagsN-terminal MBP or SUMOEnhances solubility
Media compositionSupplemented with glycerol and specific ionsSupports membrane protein folding

Why does recombinant EpsL often fail to express properly, and how can this be addressed?

Recombinant EpsL expression frequently fails due to several challenges inherent to membrane proteins. A primary factor is poor mRNA accessibility at translation initiation sites, which significantly impacts expression outcomes as demonstrated in studies of over 11,430 recombinant proteins . EpsL, being an inner membrane protein with hydrophobic regions, often causes toxicity to the host when overexpressed, leading to growth inhibition and reduced yields .

To address these challenges, researchers should implement a multi-faceted approach. First, optimize mRNA accessibility using computational tools like TIsigner that modify the first nine codons through synonymous substitutions without altering the protein sequence . This approach has been shown to dramatically improve expression success rates. Second, express EpsL as smaller functional domains rather than the full-length protein, focusing on the periplasmic domain which contains the critical interaction regions with EpsM (residues 84-135 in EpsM are involved in similar interactions) .

Use specialized expression vectors with tightly controlled, tunable promoters to minimize toxicity. Expression in membrane protein-optimized bacterial strains (such as C41/C43) provides additional tolerance. For purification, detergent screening is essential to identify optimal conditions for extracting EpsL from membranes while maintaining native structure and function .

What methodological approaches allow for verification of proper EpsL folding during recombinant expression?

Verification of proper EpsL folding during recombinant expression requires multiple complementary approaches. Functional assays represent the gold standard, where purified recombinant EpsL can be tested for its ability to interact with known binding partners, particularly EpsM. Co-immunoprecipitation and pull-down assays with recombinant EpsM can verify whether the expressed EpsL maintains its native interaction capabilities .

Biophysical characterization techniques provide valuable structural information. Circular dichroism spectroscopy can confirm secondary structure content, with properly folded EpsL showing characteristic α-helical patterns. Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) can verify that EpsL adopts the expected oligomeric state in solution. Limited proteolysis experiments compare digestion patterns between recombinant and native EpsL, with similar patterns indicating proper folding .

Researchers should also employ thermal shift assays to assess protein stability, which can be particularly informative when comparing wild-type EpsL to mutant variants. For membrane-embedded regions, fluorescence-based approaches using environment-sensitive probes can monitor the insertion of hydrophobic segments into membrane mimetics, providing evidence of correct topology .

What experimental approaches best characterize EpsL interactions with other T2S components?

Characterizing EpsL interactions with other T2S components requires a comprehensive toolkit of biochemical, biophysical, and genetic methods. Yeast two-hybrid screens provide an initial mapping of the interaction network but may give false positives for membrane proteins. Therefore, bacterial two-hybrid systems, specifically optimized for membrane protein interactions, offer more reliable results for EpsL studies .

Co-purification approaches have proven particularly effective, as demonstrated in studies where truncated EpsM mutants were analyzed for interactions with full-length EpsL. These experiments successfully mapped the region of EpsM from amino acids 84-99 as critical for stable interaction with EpsL . Similarly, co-immunoprecipitation assays provide evidence of interactions in more native-like conditions.

In vivo cross-linking coupled with mass spectrometry offers powerful insights by capturing transient interactions within the bacterial cell. Surface plasmon resonance and isothermal titration calorimetry provide quantitative binding parameters (Kd, ΔH, ΔS) for purified components. For structural characterization, X-ray crystallography of co-purified complexes remains the gold standard, though cryo-electron microscopy is increasingly valuable for visualizing larger assemblies of the secretion apparatus .

How do mutations in the periplasmic domain of EpsL affect its interactions with EpsM?

Mutations in the periplasmic domain of EpsL significantly impact its interactions with EpsM, with specific regions being particularly critical. Research has demonstrated that EpsL and EpsM form a stable complex in the inner membrane and protect each other from proteolytic degradation, highlighting the functional importance of their interaction .

Studies of truncated EpsM mutants revealed that while residues 100-135 of EpsM are necessary for homo-oligomerization, the region spanning amino acids 84-99 is specifically critical for stable interaction with EpsL . By extension, the corresponding interaction regions in EpsL's periplasmic domain are similarly crucial. Mutations in these regions can completely abolish the EpsL-EpsM interaction, leading to destabilization of both proteins and compromised T2S function .

The effects of mutations can be quantified through protein stability assays, which demonstrate increased susceptibility to proteolytic degradation when interaction domains are compromised. Co-purification efficiency dramatically decreases with mutations in key residues. Functional secretion assays using cholera toxin as a reporter show that even single amino acid substitutions in critical interaction interfaces can substantially reduce secretion efficiency, demonstrating the precision required in the assembly of this multiprotein complex .

What role does the EpsL-EpsM interaction play in maintaining T2S system integrity?

The EpsL-EpsM interaction serves as a crucial architectural element that maintains the structural and functional integrity of the T2S system in Vibrio cholerae. This interaction forms a stable inner membrane platform that anchors and properly orients other components of the secretion apparatus .

Biochemical studies have demonstrated that EpsL and EpsM protect each other from proteolytic degradation, indicating that their interaction is essential for the stability of both proteins . When this interaction is disrupted through mutations or deletions, the entire secretion system becomes compromised, leading to impaired secretion of virulence factors including cholera toxin .

The interaction appears to perform both structural and functional roles. Structurally, it helps maintain the proper architecture of the T2S apparatus spanning the cell envelope. Functionally, there is evidence suggesting that conformational changes in the EpsL-EpsM complex may contribute to the energy-dependent processes driving protein secretion . Additionally, this complex likely participates in recruiting or properly positioning other T2S components, creating a complete and functional secretion pathway necessary for V. cholerae pathogenesis .

What assays can quantitatively measure the secretion efficiency of the T2S system when studying EpsL mutants?

Quantitative assessment of T2S secretion efficiency when evaluating EpsL mutants requires robust and reproducible assays. The gold standard approach involves measuring cholera toxin secretion, as this is the primary virulence factor secreted through the T2S system in V. cholerae . This can be accomplished through ELISA-based quantification of cholera toxin in culture supernatants, providing precise numerical data on secretion efficiency.

Western blot analysis of culture supernatants and cellular fractions can determine the ratio of secreted versus cell-associated proteins, with densitometry providing quantitative measurements. For higher throughput screening of multiple EpsL mutants, researchers can employ reporter enzyme assays where enzymes naturally secreted by the T2S system (such as protease, lipase, or chitinase) are measured in culture supernatants using colorimetric or fluorometric substrates .

Real-time monitoring of secretion can be achieved by incorporating pH-sensitive GFP variants into secreted proteins, allowing dynamic visualization of the secretion process. Complementation assays in epsL deletion strains provide functional evidence, where wild-type EpsL expression vectors are compared with mutant variants for their ability to restore secretion capacity. These quantitative approaches allow researchers to correlate specific EpsL domains and residues with secretion functionality .

How can researchers distinguish between direct effects of EpsL mutations on protein function versus indirect effects on protein stability?

Distinguishing between direct functional impacts and indirect stability effects of EpsL mutations requires a systematic experimental approach. To assess protein stability, researchers should measure EpsL levels in membrane fractions via western blotting, comparing wild-type and mutant variants. Pulse-chase experiments with radiolabeled amino acids provide quantitative measurement of protein half-life, revealing whether mutations accelerate degradation .

For direct functional assessment independent of stability concerns, researchers can employ in vivo cross-linking to capture interaction partners, determining whether mutations specifically disrupt particular protein-protein interactions while maintaining others. Thermal shift assays using differential scanning fluorimetry quantify protein stability changes caused by mutations. Creating chimeric proteins where potentially destabilizing mutations are introduced into more stable EpsL homologs can separate functional from stability effects .

A comprehensive approach includes complementation assays with overexpression to compensate for potential stability issues - if overexpression of a mutant restores function, the defect likely stems from reduced stability rather than intrinsic functionality. The co-expression of interaction partners (particularly EpsM) can sometimes rescue stability defects in EpsL mutants, further distinguishing between structural and functional impacts .

What in vivo models best demonstrate the physiological relevance of EpsL in V. cholerae virulence?

The physiological relevance of EpsL in V. cholerae virulence can be effectively demonstrated through several in vivo model systems. The infant mouse colonization model represents a well-established approach, where competitive indices between wild-type and epsL mutant strains are compared following oral inoculation. This model specifically evaluates intestinal colonization efficiency, a critical stage in cholera pathogenesis dependent on toxin secretion through the T2S system .

Dictyostelium discoideum, a eukaryotic amoeba, serves as a valuable alternative model host that has revealed important insights into V. cholerae virulence mechanisms. Studies have demonstrated that the T2S system components, including EpsL, are required for cytotoxicity toward Dictyostelium, establishing a clear connection between EpsL function and virulence in this model .

For environmental persistence assessment, biofilm formation assays in conditions mimicking aquatic environments can demonstrate the contribution of EpsL to survival outside human hosts. The rugose variant of V. cholerae, associated with exopolysaccharide secretion that promotes biofilm formation, shows increased resistance to various environmental stresses. Evaluating how epsL mutations affect this phenotype provides insights into EpsL's role in environmental persistence and transmission dynamics .

What structural biology techniques provide the highest resolution data for EpsL conformational studies?

High-resolution structural analysis of EpsL presents significant challenges due to its membrane-associated nature, requiring specialized techniques for meaningful conformational insights. X-ray crystallography of isolated soluble domains (particularly the periplasmic domain) has successfully yielded atomic-resolution structures for homologous T2S components, though crystallizing full-length EpsL remains challenging due to its membrane integration .

Cryo-electron microscopy (cryo-EM) has emerged as a powerful technique for membrane protein structural biology, enabling visualization of EpsL within the context of the entire T2S apparatus without requiring crystallization. Recent advances in single-particle cryo-EM allow structures approaching 3Å resolution, revealing critical interaction interfaces .

Solution and solid-state NMR spectroscopy provide valuable dynamic information about specific domains, particularly when isotopically labeled EpsL samples can be prepared. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) maps solvent-accessible regions and conformational changes upon interaction with binding partners like EpsM. For membrane-embedded regions, site-directed spin labeling coupled with electron paramagnetic resonance (EPR) spectroscopy determines topological arrangements and distances between specific residues, providing constraints for computational modeling of full-length structures .

What are the current gaps in understanding the dynamic conformational changes of EpsL during secretion?

Despite significant progress in characterizing EpsL structure and interactions, several critical knowledge gaps remain regarding its dynamic conformational changes during active secretion. The transition states and intermediate conformations that EpsL adopts during the secretion cycle remain largely uncharacterized. Current structural data primarily capture static "snapshots" rather than the dynamic conformational landscape essential for understanding mechanism .

The energetic coupling between EpsL conformational changes and substrate translocation through the secretion apparatus remains poorly understood. While we know EpsL interacts with EpsM and other T2S components, how these interactions change during active secretion to facilitate substrate movement across the cell envelope requires further investigation .

The timing and coordination of EpsL movements relative to other T2S components during the secretion cycle remain unclear. Single-molecule approaches combining fluorescence techniques with electrophysiology could potentially track these dynamic changes in real-time. Additionally, the potential role of post-translational modifications in regulating EpsL conformational states has been minimally explored but may represent an important regulatory mechanism .

What are the most common technical challenges in purifying functional recombinant EpsL?

Purification of functional recombinant EpsL presents several technical challenges requiring systematic troubleshooting approaches. Membrane extraction efficiency represents a primary hurdle, as EpsL's hydrophobic regions often lead to incomplete solubilization from bacterial membranes. Researchers should screen multiple detergents (DDM, LDAO, Fos-choline) at various concentrations to identify optimal extraction conditions without denaturing the protein .

Protein aggregation during purification frequently occurs with EpsL, particularly after detergent exchange steps. This can be addressed by maintaining glycerol (10-15%) throughout the purification process and performing all steps at 4°C. The choice of affinity tag significantly impacts purification success, with tandem affinity purification (typically His-MBP) yielding higher purity and functionality compared to single tags .

The loss of critical interaction partners during purification may destabilize EpsL. Co-expression and co-purification with EpsM, its key binding partner, often improves stability and functionality, as these proteins have been shown to protect each other from proteolytic degradation . Size-exclusion chromatography profiles should be carefully monitored, as shifts from expected elution volumes indicate oligomerization issues or partial unfolding. Functional validation through interaction assays with other purified T2S components should be performed to confirm that the purified EpsL retains its native binding properties .

How can mRNA accessibility optimization improve recombinant EpsL expression?

mRNA accessibility optimization represents a powerful approach for improving recombinant EpsL expression based on recent research analyzing thousands of recombinant protein expression experiments. The accessibility of translation initiation sites, modeled using mRNA base-unpairing across the Boltzmann ensemble, significantly outperforms alternative features in predicting expression success .

Analysis of 11,430 recombinant protein expression experiments revealed that mRNA accessibility is the single best predictor of expression outcomes, accurately distinguishing between successful and failed expression attempts. This finding has particular relevance for challenging membrane proteins like EpsL . To optimize EpsL expression, researchers should use computational tools such as TIsigner, which employs simulated annealing to introduce synonymous substitutions within the first nine codons of the mRNA sequence .

These modifications increase the accessibility of translation initiation sites without altering the amino acid sequence, enhancing ribosome binding and translation initiation efficiency. Importantly, this approach requires only modest sequence modifications rather than complete gene redesign, making it accessible through simple PCR-based methods rather than full gene synthesis . Experimental validation has shown that higher accessibility leads to increased protein production, though researchers should be aware that this may come with slower cell growth due to metabolic burden .

How can researchers validate that recombinant EpsL retains native conformational properties?

Validating that recombinant EpsL maintains its native conformational properties requires multiple complementary approaches. Functional interaction assays provide the most relevant validation - purified recombinant EpsL should demonstrate specific binding to other T2S components, particularly EpsM, with binding affinities comparable to those observed in native systems . Co-immunoprecipitation or pull-down assays with purified interaction partners can quantitatively assess binding capacity.

Biophysical characterization through circular dichroism spectroscopy confirms secondary structure content, with properly folded EpsL showing characteristic patterns. Thermal stability profiles measured through differential scanning fluorimetry or circular dichroism can be compared between recombinant and native (or membrane-extracted) EpsL samples . Protease susceptibility patterns provide another conformational indicator - limited proteolysis followed by mass spectrometry analysis should yield fragment patterns consistent with properly folded domains .

Epitope accessibility testing using conformation-specific antibodies can verify that recombinant EpsL presents the correct surface features. For more detailed structural validation, hydrogen-deuterium exchange mass spectrometry maps solvent-exposed regions, which should match theoretical predictions based on structural models. Finally, complementation assays in epsL deletion strains provide the ultimate functional validation - if recombinant EpsL restores secretion capacity when expressed in these strains, it likely retains essential native conformational properties .

What emerging technologies might advance our understanding of EpsL function in the T2S system?

Several emerging technologies hold particular promise for advancing our understanding of EpsL function within the T2S system. Cryo-electron tomography (cryo-ET) with subtomogram averaging now enables visualization of the T2S apparatus in situ within bacterial membranes, potentially revealing the native architecture and conformational states of EpsL in its cellular context without artificial overexpression .

Single-molecule fluorescence resonance energy transfer (smFRET) techniques applied to reconstituted systems could track real-time conformational changes in EpsL during active secretion, providing insights into the dynamic aspects of its function. This approach could reveal transient intermediates missed by ensemble methods . Recent advances in mass photometry allow label-free characterization of protein complexes at the single-molecule level, potentially revealing the stoichiometry and assembly pathways of EpsL-containing subcomplexes .

Genome-wide CRISPRi screens in V. cholerae could identify previously unknown genetic interactions with epsL, revealing new functional connections. Microfluidic secretion assays coupled with high-speed microscopy might capture the kinetics of secretion events at the single-cell level, correlating EpsL conformational states with secretion activity. These emerging approaches, especially when combined in integrative studies, promise to overcome current limitations in understanding EpsL's precise mechanistic contributions to T2S system function .

How might structural insights into EpsL contribute to novel antimicrobial development?

Structural insights into EpsL offer promising avenues for novel antimicrobial development targeting the T2S system, a critical virulence mechanism in Vibrio cholerae. The EpsL-EpsM interaction interface represents a particularly attractive target due to its essential role in maintaining T2S system integrity . High-resolution structural data of this interface could enable structure-based design of small molecule inhibitors that disrupt this protein-protein interaction.

As EpsL and EpsM protect each other from proteolytic degradation , compounds that interfere with their interaction would potentially destabilize both proteins, causing degradation of key T2S components and impairing toxin secretion. Since the T2S system spans multiple bacterial species beyond V. cholerae (including Pseudomonas aeruginosa, Klebsiella oxytoca, and Erwinia chrysanthemi) , inhibitors targeting conserved features of EpsL might have broad-spectrum activity against multiple gram-negative pathogens.

Fragment-based drug discovery approaches coupled with biophysical validation techniques like surface plasmon resonance could identify initial chemical matter targeting EpsL. Peptidomimetic strategies based on the critical interaction regions (particularly involving the periplasmic domain) could yield selective inhibitors. The periplasmic localization of key EpsL interaction domains is advantageous for drug development, as compounds wouldn't need to cross the inner membrane barrier to reach their target .

What approaches might improve the stability and yield of recombinant EpsL for structural studies?

Improving stability and yield of recombinant EpsL for structural studies requires innovative approaches beyond conventional optimization. Systematic fusion partner screening represents a promising strategy, particularly using recently developed tags specifically designed for membrane proteins. The MISTIC tag from Bacillus subtilis, which assists membrane insertion, has shown success with challenging membrane proteins and might improve EpsL expression .

Co-expression with stabilizing partners, particularly EpsM, leverages the natural protection these proteins provide each other against proteolytic degradation . Expression constructs can be designed that produce both proteins from a single transcript, ensuring stoichiometric production. For crystallography purposes, creating fusion constructs where flexible regions of EpsL are replaced with well-folding domains (like T4 lysozyme) has proven successful for other membrane proteins .

Directed evolution approaches using display technologies could select for EpsL variants with improved expression and stability. Cell-free expression systems provide another alternative, allowing immediate incorporation into nanodiscs or other membrane mimetics upon translation, potentially avoiding aggregation issues. For NMR studies requiring isotopic labeling, selective amino acid labeling strategies can focus on specific domains of interest while minimizing spectral complexity . Ultimately, combining these approaches with high-throughput screening methodologies offers the best chance of obtaining sufficient quantities of stable, functional EpsL for comprehensive structural studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.