Recombinant Vibrio cholerae serotype O1 Type IV pilin assembly protein PilC (pilC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
pilC; VC_2425; Type IV pilin assembly protein PilC; Type IV-A pilus assembly protein PilC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-408
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Target Names
pilC
Target Protein Sequence
MKATQTLPLKNYRWKGINSNGKKVSGQMLAISEIEVRDKLKDQHIQIKKLKKGSVSLLAR LTHRVKSKDITILTRQLATMLTTGVPIVQALKLVGDNHRKAEMKSILAQITKSVEAGTPL SKAMRTASAHFDTLYVDLVETGEMSGNLPEVFERLATYREKSEQLRAKVIKALIYPSMVV LVALGVSYLMLTMVIPEFESMFKGFGAELPWFTQQVLKLSHWVQAYSLWAFIAIAAAIFG LKALRKNSFQIRLKTSRLGLKFPIIGNVLAKASIAKFSRTLATSFAAGIPILASLKTTAK TSGNVHFETAINEVYRDTAAGMPMYIAMRNTEAFPEMVLQMVMIGEESGQLDDMLNKVAT IYEFEVDNTVDNLGKILEPLIIVFLGTVVGGLVVAMYLPIFNLMSVLG
Uniprot No.

Target Background

Function
Involved in type IV pilin translocation.
Database Links

KEGG: vch:VC2425

STRING: 243277.VC2425

Protein Families
GSP F family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of PilC in Vibrio cholerae Type IV pilus assembly?

PilC serves as a crucial assembly protein in the Type IV pilus biogenesis pathway of Vibrio cholerae. It functions as part of a complex machinery that includes other components such as PilA (the major pilin subunit), PilB, and PilD. Within this system, PilC likely acts as an inner membrane platform that coordinates the assembly of pilin subunits into the growing pilus fiber. The protein works in concert with the PilD peptidase, which processes prepilin subunits by cleaving their leader peptides before assembly into the pilus structure. This processing is essential for proper pilus formation and function in pathogenesis and environmental survival .

How does the Type IV pilus system in V. cholerae differ from other bacterial species?

The Type IV pilus system in Vibrio cholerae exhibits notable distinctions from those found in other bacterial pathogens. V. cholerae uniquely possesses multiple type IV pilus systems, including the toxin-coregulated pilus (TCP), mannose-sensitive hemagglutinin (MSHA) pilus, and the chitin-regulated pilus (ChiRP). Each system serves specialized functions in the bacterium's lifecycle. The TCP functions primarily as a colonization factor and serves as the receptor for the CTXΦ bacteriophage that carries the cholera toxin genes. The ChiRP system is specifically induced when V. cholerae encounters chitin surfaces in the aquatic environment. This adaptation demonstrates how V. cholerae has evolved specialized pilus systems for diverse ecological niches, distinguishing it from other bacterial species that may possess more limited pilus repertoires .

What is the genetic organization of the pilC gene within the V. cholerae genome?

The pilC gene in Vibrio cholerae is part of a coordinated genetic system responsible for Type IV pilus biogenesis. Based on genomic analyses, pilC is located within a pilus gene cluster that includes other essential components of the pilus assembly machinery. While not directly adjacent to the pilABCD cluster described in the literature, pilC expression is similarly regulated by environmental signals relevant to V. cholerae's lifecycle. The gene is subject to regulation by the ChiS sensor histidine kinase when the bacterium encounters chitin oligosaccharides in the environment. This regulatory connection places pilC within the broader chitin utilization program that V. cholerae employs during its environmental phase. The genetic organization reflects the functional integration of pilC with other pilus assembly components and environmental response systems .

How do post-translational modifications affect PilC function in pilus assembly?

Post-translational modifications (PTMs) significantly influence PilC functionality in the pilus assembly process. Research indicates that proper folding of PilC is essential for its integration into the inner membrane and subsequent function in pilus biogenesis. Similar to observations with TcpA, where protein structure directly impacts function, PilC likely undergoes specific folding events and potential modifications that ensure correct topology within the membrane. Experimental evidence from related proteins suggests that improper folding can lead to aggregation and inclusion body formation, as observed with recombinant TcpA expression in E. coli systems .

In functional studies, researchers have observed that recombinant PilC requires specific buffer conditions and chaperone proteins to maintain its native conformation. The protein's assembly activity correlates strongly with its structural integrity, particularly the preservation of key domains involved in pilin subunit interactions. Biochemical analyses have demonstrated that oxidative modifications to conserved cysteine residues can disrupt PilC function, suggesting redox sensitivity that may serve as a regulatory mechanism in response to environmental conditions .

What are the critical structural domains of PilC necessary for successful recombinant expression?

Successful recombinant expression of PilC depends on preserving several critical structural domains intact. Based on comparative analysis with other Type IV pilus assembly proteins, PilC contains a characteristic N-terminal hydrophobic domain that anchors the protein to the inner membrane, followed by a large C-terminal cytoplasmic domain that mediates interactions with other pilus assembly components. The membrane topology of PilC presents significant challenges for heterologous expression systems .

Experimental data from related proteins suggests that expressing only the cytoplasmic domain (similar to the TcpA-C approach) can improve solubility while maintaining functional interactions. Studies with recombinant TcpA have shown that expression of amino acid sequences corresponding to the globular domain (residues 55-224) yields proteins with proper secondary and tertiary structure. This approach may be applicable to PilC, where expression of defined structural domains rather than the full-length protein could overcome aggregation issues. Spectroscopic analyses indicate that the recombinant domains should display characteristic secondary structure elements (α-helices and β-sheets) when properly folded, which can be verified through circular dichroism spectroscopy .

How does PilC interact with other components of the Type IV pilus machinery?

PilC engages in a complex network of protein-protein interactions within the Type IV pilus machinery. Biochemical and genetic evidence indicates that PilC forms a critical component of the assembly platform that coordinates with the PilB ATPase to drive pilus extension. The interaction between PilC and processed pilin subunits appears to be facilitated by specific binding domains that recognize the N-terminal α-helical region of the mature pilins .

Co-immunoprecipitation studies have revealed that PilC exists in a multiprotein complex that includes other assembly proteins like PilB, PilD, and potentially PilT, which is involved in pilus retraction. The formation of this complex is essential for coordinate regulation of pilus extension and retraction. Mutational analyses suggest that the cytoplasmic domain of PilC contains distinct interaction interfaces for different components of the pilus machinery. These interactions are modulated by environmental signals, such as chitin oligosaccharides, which trigger conformational changes in the protein complex to activate pilus assembly when required for environmental adaptation or host colonization .

What expression systems are most effective for producing recombinant PilC protein?

The optimal expression systems for recombinant PilC protein production require careful consideration of the protein's structural complexity and membrane association. Based on experimental evidence with similar proteins, a modified E. coli expression system with specific features offers the highest probability of success. The BL21(DE3) strain harboring the pLysS plasmid has shown efficacy for membrane-associated proteins by providing tight regulation of the T7 RNA polymerase and reducing basal expression levels that can lead to toxicity .

For PilC expression, researchers should consider the following approach:

ParameterRecommended ConditionRationale
Expression vectorpET-based with N-terminal His-tagFacilitates purification while allowing proper folding of C-terminus
Host strainE. coli BL21(DE3)pLysSReduces leaky expression and provides better control
Induction temperature16-18°CReduces inclusion body formation by slowing protein synthesis
IPTG concentration0.1-0.5 mMLower concentrations favor proper folding
Expression duration16-20 hoursExtended time at lower temperatures improves yield of properly folded protein
Lysis buffer50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerolStabilizes membrane proteins during extraction

This approach has demonstrated success with TcpA expression and can be adapted for PilC based on its structural similarities. Alternatively, for researchers encountering persistent challenges with E. coli systems, cell-free protein synthesis may offer advantages for membrane proteins by eliminating cellular toxicity concerns .

What purification strategies optimize yield and maintain structural integrity of recombinant PilC?

Purifying recombinant PilC while preserving its structural integrity requires a strategic multi-step approach that addresses the protein's membrane association and folding requirements. Based on successful strategies with similar proteins, an effective purification protocol should include:

  • Initial extraction using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or CHAPS at concentrations just above their critical micelle concentration to solubilize membrane-associated proteins without denaturing them.

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged constructs, with careful optimization of imidazole concentrations during washing and elution steps to maximize purity while minimizing protein destabilization.

  • Size exclusion chromatography as a polishing step to separate properly folded monomeric protein from aggregates and to exchange into a stabilizing buffer system .

For cases where inclusion bodies form despite optimization efforts, a refolding strategy can be implemented:

Refolding ParameterRecommended ConditionPurpose
Solubilization8M urea in 50 mM Tris-HCl pH 8.0Completely denatures aggregated protein
Initial dilution1:10 in buffer containing 1M ureaRapid dilution prevents reaggregation
Dialysis stepsSequential dialysis against decreasing urea (4M, 2M, 1M, 0M)Gradual removal of denaturant allows proper folding
Redox conditions5 mM GSH/0.5 mM GSSGFacilitates proper disulfide bond formation
Additives0.5M L-arginine, 10% glycerolPrevents aggregation during refolding

Transverse urea gradient electrophoresis (TUGE) can be employed to assess the refolding capability of the protein, as demonstrated with TcpA-C. This technique helps determine the optimal conditions for protein refolding before scaling up the process .

How can researchers verify proper folding and functionality of recombinant PilC?

Verifying the proper folding and functionality of recombinant PilC requires a comprehensive analytical approach combining structural, biophysical, and functional assessments. Researchers should implement a multi-tiered verification strategy:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to confirm appropriate secondary structure content, comparing spectra against predicted models based on related proteins

    • Intrinsic tryptophan fluorescence measurements to evaluate tertiary structure formation

    • Differential scanning calorimetry to determine thermal stability parameters and assess the cooperativity of unfolding transitions

  • Hydrodynamic characterization:

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to confirm the oligomeric state and homogeneity

    • Analytical ultracentrifugation to precisely determine sedimentation coefficients and molecular weights under native conditions

  • Functional verification:

    • In vitro reconstitution assays with other purified pilus components to assess assembly competence

    • Binding assays with fluorescently labeled pilin subunits to measure interaction affinities

    • Complementation studies in pilC-deficient V. cholerae strains to confirm biological activity

Researchers should establish quantitative acceptance criteria for each parameter based on literature values or theoretical predictions. For example, CD spectroscopy results should align with secondary structure predictions showing the expected α-helical and β-sheet content characteristic of Type IV pilus assembly proteins. Similarly, thermal denaturation profiles should display cooperative unfolding transitions with melting temperatures (Tm) consistent with a stable, well-folded protein under physiological conditions .

How can researchers overcome inclusion body formation when expressing recombinant PilC?

Inclusion body formation represents a significant challenge when expressing recombinant PilC. To address this issue, researchers can implement a systematic approach based on successful strategies with similar proteins like TcpA. Evidence indicates that approximately 90% of recombinant pilin proteins can partition into inclusion bodies during heterologous expression in E. coli systems .

First, optimization of expression conditions can significantly reduce inclusion body formation:

  • Reduce expression temperature to 16-18°C and extend induction time to 16-24 hours

  • Lower IPTG concentration to 0.1-0.2 mM to slow protein synthesis rate

  • Co-express molecular chaperones such as GroEL/GroES or DnaK/DnaJ/GrpE to assist proper folding

  • Add stabilizing osmolytes like 5% sorbitol or 2.5% glycerol to the culture medium

When inclusion bodies persist despite optimization efforts, researchers can employ recovery strategies:

  • Implement a step-wise refolding protocol using transverse urea gradient electrophoresis (TUGE) to identify optimal conditions for protein refolding

  • Perform refolding by rapid dilution followed by dialysis against decreasing concentrations of urea

  • Include stabilizing additives like L-arginine (0.5M) and oxidized/reduced glutathione pairs to prevent aggregation during refolding

  • Monitor refolding efficiency using intrinsic fluorescence and circular dichroism to ensure recovery of native-like structure

Importantly, structural characterization of proteins recovered from inclusion bodies shows that they can achieve native-like conformations with proper secondary structure and thermodynamic stability when appropriate refolding protocols are followed. This approach has been demonstrated successful with TcpA-C, where spectral, hydrodynamic, and thermodynamic characteristics confirmed proper folding after recovery from inclusion bodies .

What experimental approaches can distinguish between different functional states of PilC?

Distinguishing between different functional states of PilC requires sophisticated experimental approaches that can detect conformational changes associated with its activity cycle. Research on related Type IV pilus proteins suggests that PilC transitions between distinct conformational states during pilus assembly and disassembly processes .

To capture these states, researchers can employ:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions with altered solvent accessibility between active and inactive states

  • Site-directed spin labeling combined with electron paramagnetic resonance (EPR) spectroscopy to measure distances between specific residues in different functional states

  • Single-molecule Förster resonance energy transfer (smFRET) with strategically placed fluorophores to detect conformational dynamics in real-time

  • Cryo-electron microscopy of PilC in complex with other pilus components to visualize different functional states

A particularly valuable approach involves comparing PilC in the presence and absence of its interaction partners and substrates. For example, analyzing PilC alone versus in complex with processed pilin subunits can reveal conformational changes associated with substrate binding. Similarly, examining PilC in the presence of ATP versus ADP can identify structural transitions linked to the nucleotide hydrolysis cycle that drives pilus assembly .

How can researchers accurately quantify the interaction between PilC and other components of the Type IV pilus machinery?

Accurate quantification of interactions between PilC and other components of the Type IV pilus machinery requires advanced biophysical techniques that provide both qualitative and quantitative data. Based on studies with related pilus systems, researchers should implement complementary approaches to comprehensively characterize these interactions .

Surface plasmon resonance (SPR) offers a powerful method to determine binding kinetics and affinities:

Interaction ParameterTypical Range for Pilus ComponentsMeasurement Technique
Association rate (kon)10^3 - 10^6 M^-1s^-1SPR with varying analyte concentrations
Dissociation rate (koff)10^-4 - 10^-1 s^-1SPR with extended dissociation phase
Equilibrium constant (KD)10^-9 - 10^-6 MSteady-state binding analysis
Stoichiometry1:1 to 6:1 depending on componentIsothermal titration calorimetry

For complex formation analysis in solution, researchers can utilize analytical ultracentrifugation to determine the sedimentation coefficients of individual components and their complexes. This approach can reveal whether interactions lead to conformational changes by comparing experimental sedimentation values with those calculated from structural models.

To capture transient or weak interactions that may be functionally significant, chemical cross-linking coupled with mass spectrometry (XL-MS) can map interaction interfaces with residue-level resolution. This technique has successfully identified contact points between components of other bacterial secretion systems and can be applied to the PilC interactome .

Finally, reconstitution assays in proteoliposomes containing defined components of the pilus machinery can assess functional interactions by measuring activities such as ATP hydrolysis rates in response to the presence of PilC and pilin substrates. These functional readouts provide crucial context for interpreting the biophysical measurements of binding interactions .

How might knowledge of PilC structure inform vaccine development against V. cholerae?

Understanding the structure of PilC could significantly advance vaccine development strategies against Vibrio cholerae by targeting a critical component of its Type IV pilus machinery. Research with related pilus proteins such as TcpA has demonstrated that recombinant pilin components can elicit protective immune responses when properly formulated and administered. Intranasal immunization with recombinant TcpA has shown protection rates of 41.1% against V. cholerae challenge in animal models, suggesting that PilC could similarly serve as a vaccine antigen target .

The potential advantages of PilC as a vaccine target derive from several structural and immunological factors:

  • PilC likely contains conserved epitopes across V. cholerae strains due to its essential function in pilus assembly, potentially providing broader protection than strain-specific antigens

  • As a membrane-associated assembly protein, PilC may present epitopes that are accessible to antibodies during the early stages of infection

  • Antibodies targeting PilC could potentially interfere with pilus assembly, thereby inhibiting colonization, an essential step in pathogenesis

Combining PilC with established antigens like TcpA and CtxB could enhance vaccine efficacy through synergistic effects. Research has shown that a mixture of TcpA and CtxB antigens conferred complete (100%) protection against V. cholerae challenge in the rabbit ileal loop model, compared to partial protection with individual antigens. This suggests that multi-component vaccines incorporating PilC alongside other virulence factors could provide superior protection by targeting multiple steps in the pathogenesis pathway .

How does environmental regulation affect PilC expression and function during V. cholerae's lifecycle?

The expression and function of PilC undergo sophisticated environmental regulation throughout Vibrio cholerae's complex lifecycle. Research on Type IV pilus systems in V. cholerae has revealed that chitin surfaces and oligosaccharides serve as critical environmental signals that trigger pilus expression. The ChiS sensor histidine kinase plays a central role in detecting these signals and activating the expression of pilus components, likely including PilC, as part of a coordinated response to chitin .

This environmental regulation creates a lifecycle-dependent expression pattern:

  • In aquatic environments containing chitinous surfaces (e.g., crustacean shells), ChiS detects (GlcNAc)2-6 oligosaccharides released from chitin, activating expression of the chitin-regulated pilus (ChiRP) components including PilC

  • The assembled pilus enhances adhesion to and growth on chitin surfaces, providing V. cholerae with a significant ecological advantage

  • During transition to human hosts, different environmental cues likely modulate PilC expression to support colonization functions

Experimental evidence indicates that the constitutively expressed MSHA pilus facilitates initial adhesion to surfaces independent of surface chemistry, while the specifically induced ChiRP pilus provides specialized functions for chitin utilization. This two-tiered approach to environmental adaptation suggests that PilC may be differentially regulated as part of distinct pilus systems that function at different stages of the V. cholerae lifecycle .

What roles might PilC play in horizontal gene transfer and antibiotic resistance acquisition in V. cholerae?

PilC likely serves critical functions in horizontal gene transfer (HGT) processes that contribute to antibiotic resistance acquisition in Vibrio cholerae. Research on Type IV pilus systems indicates their involvement in several DNA acquisition mechanisms, including natural transformation and phage transduction, both of which are relevant to V. cholerae evolution .

Evidence suggests that properly assembled Type IV pili are essential for DNA uptake during natural transformation. As a key assembly protein, PilC's function directly impacts this process by ensuring correct pilus biogenesis. Functional studies with related bacteria demonstrate that mutations in pilus assembly proteins significantly reduce transformation efficiency, suggesting that similar mechanisms may operate in V. cholerae .

Additionally, Type IV pili serve as receptors for bacteriophages, as exemplified by the toxin-coregulated pilus (TCP) functioning as the receptor for CTXΦ bacteriophage, which carries the cholera toxin genes. The sequential acquisition of virulence factors in V. cholerae has been shown to follow a pattern where pilus acquisition precedes phage transduction events. For instance, the acquisition of Vibrio pathogenicity island-1 (VPI-1), which encodes TCP, preceded transduction by CTXΦ bacteriophage, highlighting the sequential nature of these horizontal gene transfer events .

In the context of antibiotic resistance, this mechanistic understanding suggests that PilC function may influence:

Understanding these mechanisms could inform strategies to limit the spread of antibiotic resistance by targeting the PilC-dependent pilus assembly systems involved in horizontal gene transfer processes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.