Recombinant Vibrio cholerae serotype O1 Uncharacterized membrane protein VC_1358 (VC_1358)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend consulting your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance to arrange for additional fees.
Notes
Repeated freeze-thaw cycles are discouraged. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, it is recommended to briefly centrifuge the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference for your own preparations.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid protein has a shelf life of 6 months at -20°C/-80°C, while lyophilized protein can be stored for up to 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. To ensure optimal stability, avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is finalized during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
VC_1358; Uncharacterized membrane protein VC_1358
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-223
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Target Names
VC_1358
Target Protein Sequence
MNTPMFTRTSSLERTLETNKVLKNTYFLLSMTLVTSAIAAMATMAIGISPIVALVMQLAA IGILFFVMPKAINSSSGLVWTFVFTGLMGGALGPMLNFYAAMPNGPIVIAQALGLTGMVF LGLSAYTITSKKDFSFMRNFLFAGLIIVIVAALINIFVGSTVAHLAISSVSALVFSGFIL FDTSRIVRGEETNYISATISMYLNILNLFTSLLSILGIMNNND
Uniprot No.

Target Background

Database Links

KEGG: vch:VC1358

STRING: 243277.VC1358

Protein Families
BI1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the predicted structure and topology of VC_1358 in Vibrio cholerae O1?

While VC_1358 remains largely uncharacterized, bioinformatic analysis suggests it belongs to the family of outer membrane proteins in V. cholerae. Initial structural prediction approaches would include transmembrane domain analysis using TMHMM, TOPCONS, or Phobius algorithms to establish membrane-spanning regions. For outer membrane proteins from V. cholerae, beta-barrel structures are common, as seen in related proteins like TolC that forms channels across the outer membrane . Researchers should employ multiple prediction tools and validate findings with experimental approaches such as protease accessibility assays to confirm topology predictions.

How can I optimize expression of recombinant VC_1358 protein for structural studies?

Recombinant membrane protein expression presents significant challenges. For VC_1358 expression, a systematic approach is recommended:

  • Expression system selection: E. coli BL21(DE3) with specialized vectors like pET or pBAD for tight regulation

  • Fusion tag optimization: Test multiple tags (His6, MBP, SUMO) at both N and C termini

  • Growth conditions: Optimize temperature (typically 16-25°C post-induction), inducer concentration, and media composition

The key challenge for membrane proteins like VC_1358 is proper folding. Using slow induction protocols (0.1-0.5 mM IPTG) at reduced temperatures (18°C) often increases the yield of properly folded protein. For particularly difficult cases, specialized E. coli strains like C41(DE3) or C43(DE3) designed for membrane protein expression should be considered .

What purification methods are most effective for VC_1358?

Purification of membrane proteins like VC_1358 requires careful detergent selection and optimization. A recommended workflow includes:

  • Membrane isolation: Differential centrifugation following cell disruption

  • Detergent screening: Test a panel of detergents including:

    • Mild detergents: DDM, LMNG, DMNG

    • Harsh detergents: SDS, Triton X-100 (for initial solubilization only)

    • Newer amphipols: PMAL-C8

  • Purification steps:

    • IMAC (if His-tagged) with detergent in all buffers

    • Size exclusion chromatography for final polishing

    • Consider detergent exchange during purification

Monitoring protein stability throughout purification is critical using techniques like dynamic light scattering or thermal shift assays . For V. cholerae membrane proteins, pH and salt concentration optimization is particularly important as these parameters significantly affect stability.

How can I determine if VC_1358 interacts with lipopolysaccharide components like other V. cholerae membrane proteins?

Given that some V. cholerae membrane proteins like TolC interact with lipopolysaccharides , investigating potential LPS interactions with VC_1358 is valuable. Recommended methodologies include:

  • Co-immunoprecipitation: Using anti-VC_1358 antibodies to pull down associated LPS

  • Surface plasmon resonance (SPR): Immobilizing purified VC_1358 and flowing LPS components

  • Microscale thermophoresis (MST): Detecting binding-induced changes in thermophoretic mobility

  • LPS-deficient mutant studies: Expressing VC_1358 in strains with different LPS compositions

The methodology should be adapted from approaches used with TolC, which has been shown to interact with the core oligosaccharide of LPS in V. cholerae . Control experiments using known LPS-interacting proteins from V. cholerae should be included.

What reconstitution systems are most appropriate for functional studies of VC_1358?

For functional characterization of VC_1358, reconstitution into membrane mimetic systems is essential. Options include:

  • Liposomes: Simple vesicles composed of defined lipid mixtures

  • Proteoliposomes: Liposomes with incorporated VC_1358

  • Giant Unilamellar Vesicles (GUVs): Larger vesicles allowing microscopic visualization

GUVs represent an excellent platform for studying membrane proteins like VC_1358 due to their cell-like size (5-20 μm diameter) which reduces curvature stress compared to smaller vesicles . For VC_1358, GUVs can be prepared using:

  • PVA-assisted swelling: Works well with physiological salt concentrations needed for V. cholerae proteins

  • Electroformation: Higher yield but potentially limited by salt sensitivity

Reconstitution via charge-mediated fusion is particularly promising, where VC_1358 is first reconstituted into small unilamellar vesicles containing positively charged lipids, then fused with negatively charged GUVs (PC:PG ratio of 7:3) . This approach preserves protein orientation and allows for direct microscopic observation of protein function.

How might VC_1358 contribute to V. cholerae pathogenesis based on its genomic context?

Analysis of the genomic neighborhood of VC_1358 in V. cholerae O1 El Tor N16961 can provide functional insights. Chromosome 1 of V. cholerae contains numerous virulence genes encoding toxins, adhesins, and surface antigens . While specific information about VC_1358 is limited, its presence on chromosome 1 suggests potential roles in:

  • Cell envelope integrity: Like other membrane proteins that maintain outer membrane structure

  • Virulence factor secretion: Potentially forming part of secretion systems for toxins

  • Antimicrobial resistance: Possibly contributing to efflux systems similar to TolC

Researchers should employ comparative genomics across multiple V. cholerae strains to identify conservation patterns, which can indicate functional importance. Proximity to known virulence gene clusters or mobile genetic elements (MGEs) would be particularly informative .

How can I investigate the role of VC_1358 in bacteriophage resistance in V. cholerae?

Some V. cholerae membrane proteins serve as phage receptors, with mutations conferring resistance. TolC, for example, is a co-receptor for phage VP3 . To investigate VC_1358's potential role in phage interactions:

  • Phage susceptibility testing: Compare wild-type and VC_1358 deletion mutants

  • Direct binding assays: Purified VC_1358 immobilized on surfaces exposed to labeled phage

  • Competitive inhibition: Test if soluble VC_1358 blocks phage infection

  • Sequence analysis: Examine natural variants of VC_1358 in phage-resistant strains

Focus on exposed loops that might interact with phage components, similar to the loops at positions 78, 290, and 291 in TolC that are critical for phage binding . Site-directed mutagenesis of predicted surface-exposed regions could identify key interaction residues.

What approaches can determine if VC_1358 forms homo-oligomeric complexes or interacts with other membrane proteins?

Membrane proteins often function as complexes. To investigate VC_1358's quaternary structure:

MethodApplicationAdvantagesLimitations
Blue Native PAGEDetergent-solubilized complexesSimple, widely accessibleLimited resolution
Crosslinking Mass SpectrometryIdentify interaction sitesProvides residue-level detailTechnically challenging
FRETIn vivo interactionsWorks in native environmentRequires fluorescent tagging
Single-particle cryo-EMHigh-resolution structureNo crystallization neededRequires stable, pure complexes

For V. cholerae membrane proteins, chemical crosslinking with agents like DSP or formaldehyde followed by immunoprecipitation has been successfully used to capture transient interactions. Bacterial two-hybrid systems specifically optimized for membrane proteins can also identify potential interaction partners .

How can I address protein degradation issues when working with recombinant VC_1358?

Membrane proteins like VC_1358 are particularly susceptible to degradation. Effective strategies include:

  • Protease inhibitor optimization: Use cocktails containing PMSF, leupeptin, pepstatin A, and EDTA

  • Temperature control: Maintain samples at 4°C throughout preparation

  • Buffer optimization: Test buffers with varying pH (7.0-8.0) and salt concentrations (100-500 mM NaCl)

  • Detergent selection: Some detergents better protect against proteolysis; compare DDM, LMNG, and others

For V. cholerae membrane proteins specifically, addition of 10% glycerol to all buffers has been shown to enhance stability. If C-terminal degradation is observed, consider using C-terminal tags that might protect against exoproteases .

What strategies can overcome inclusion body formation when expressing VC_1358?

Inclusion body formation is common with membrane proteins. If VC_1358 forms inclusion bodies, consider:

  • Solubilization strategies:

    • Mild detergents: Start with 1% DDM

    • Chaotropic agents: 8M urea or 6M guanidine HCl followed by step-wise dialysis

    • On-column refolding: Bind denatured protein to affinity resin, then remove denaturant gradually

  • Expression modifications:

    • Reduce expression rate: Lower temperature (16°C) and inducer concentration

    • Co-express with chaperones: GroEL/GroES or DnaK/DnaJ/GrpE systems

    • Use fusion partners: MBP or SUMO tags can enhance solubility

  • Alternative expression systems:

    • Cell-free expression systems with added liposomes or nanodiscs

    • Alternative hosts like C43(DE3) E. coli strain designed for toxic membrane proteins

How can I assess the potential role of VC_1358 in antibiotic resistance?

Given that many outer membrane proteins in Gram-negative bacteria contribute to antibiotic resistance, VC_1358 may play similar roles. To investigate:

  • MIC determination: Compare minimum inhibitory concentrations between wild-type and VC_1358 deletion strains across multiple antibiotic classes

  • Efflux assays: Measure accumulation of fluorescent substrates like ethidium bromide or Nile red

  • Gene expression analysis: Examine if VC_1358 expression changes in response to antibiotic stress

  • Complementation studies: Restore VC_1358 expression in deletion mutants to confirm phenotypes

Potential antibiotic classes to test include β-lactams, tetracyclines, and macrolides, which are often affected by outer membrane permeability and efflux systems in V. cholerae .

What methods can determine if VC_1358 functions as an ion channel or transporter?

For functional characterization of potential transport activities:

  • Proteoliposome-based flux assays: Reconstitute VC_1358 into liposomes loaded with fluorescent indicators for:

    • pH (BCECF, pyranine)

    • Ions (Sodium Green, PBFI for K+)

    • Small molecules (fluorescent substrates)

  • Electrophysiology approaches:

    • Planar lipid bilayer recordings

    • Patch-clamp of giant proteoliposomes

    • Solid-supported membrane electrophysiology

  • In vivo transport assays:

    • Complementation of E. coli transport-deficient strains

    • Radioactive substrate uptake measurements

    • Growth dependence on specific substrates

The experimental platform using GUVs with reconstituted membrane proteins is particularly valuable for transport studies. GUVs can be prepared with pH-sensitive fluorophores like pyranine to monitor proton transport, and tight membranes that resist small substrate and proton leakage can be achieved through proper preparation methods .

What are the most promising structural determination methods for VC_1358?

For membrane proteins like VC_1358, several structural approaches should be considered:

  • X-ray crystallography: Requires:

    • Detergent screening (typically 20-30 detergents)

    • Lipidic cubic phase (LCP) crystallization

    • Crystal optimization with additives

  • Cryo-electron microscopy:

    • Single-particle analysis for proteins >100 kDa

    • Use of antibody fragments to increase particle size

    • Reconstitution in nanodiscs to maintain native lipid environment

  • NMR spectroscopy:

    • Suitable for smaller domains or fragments

    • Solid-state NMR for full-length protein in lipid bilayers

    • Solution NMR for soluble domains

  • Integrative approaches:

    • Combine low-resolution cryo-EM with computational modeling

    • Validate with crosslinking mass spectrometry data

    • Use evolutionary coupling analysis for constraint-based modeling

For V. cholerae membrane proteins, detergent solubilized samples in DDM have been successfully used for structural studies. Protein stability in detergent solutions should be carefully monitored, as detergent-induced destabilization is a common cause of structural study failure .

How can hydrogen-deuterium exchange mass spectrometry (HDX-MS) be applied to study VC_1358 dynamics?

HDX-MS provides valuable information about protein dynamics and ligand binding sites. For VC_1358:

  • Experimental setup:

    • Optimize detergent concentration to maintain function while minimizing MS interference

    • Use short deuterium labeling times (10s-1000s) to capture fast-exchanging regions

    • Perform rapid quenching (pH 2.5, 0°C) to minimize back-exchange

  • Data analysis focus:

    • Identify surface-exposed regions (fast exchange)

    • Map potential binding pockets (protected upon ligand addition)

    • Detect conformational changes (altered exchange patterns)

  • Applications:

    • Compare VC_1358 dynamics in different detergents or lipid environments

    • Identify regions protected upon substrate binding

    • Map interaction interfaces with other V. cholerae proteins

HDX-MS is particularly valuable for membrane proteins like VC_1358 where crystallization is challenging, providing medium-resolution structural information and dynamics data in near-native conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.