Recombinant Vibrio cholerae serotype O1 Universal stress protein B homolog (uspB)

What is the Universal stress protein B homolog (uspB) in Vibrio cholerae and how is it characterized?

The Universal stress protein B homolog (uspB) is part of the Universal stress protein (USP) superfamily, a group of conserved genes found across bacteria, archaea, fungi, protozoa, and plants. In Vibrio cholerae serotype O1, uspB is characterized by the presence of the conserved G2×G9×GS motif typical of USP family proteins . The full-length protein consists of 107 amino acids with the sequence: MISGDTILFALMLVTAINVARYVTALRSLIYIMREAHPLLYQQVDGRGFFTTHGNVTKQVRLYHYLKSREYHHHHDPVFTGKCDRVRELFILSGSLLVLTTVVAFML . Like other USP family members, uspB is induced during exposure to environmental stressors such as nutrient starvation, extreme temperatures, high salinity, and antimicrobial compounds, serving as part of the bacterial stress response mechanism .

What experimental approaches are recommended for studying uspB function in Vibrio cholerae?

For studying uspB function in Vibrio cholerae, a multi-faceted experimental approach is recommended. Begin with gene expression analysis under various stress conditions using quantitative PCR or RNA sequencing to establish baseline expression patterns . For functional characterization, both gene knockout and overexpression studies are valuable - these can be designed using the randomized block design to control for variables such as bacterial strain differences . Protein-protein interaction studies using pull-down assays or yeast two-hybrid systems can identify binding partners. ATP binding capabilities should be assessed through biochemical assays, as nucleotide binding is critical for the function of many USPs, similar to what has been observed with the mycobacterial USP Rv2624c . For phenotypic analysis, survival assays under various stress conditions and infection models using human cell lines such as THP-1 monocytes can provide insights into the role of uspB in virulence and stress resistance .

How should recombinant uspB protein be properly stored and handled in laboratory settings?

Recombinant Vibrio cholerae serotype O1 Universal stress protein B homolog (uspB) should be stored at -20°C to -80°C upon receipt, with aliquoting necessary for multiple use to prevent protein degradation from repeated freeze-thaw cycles . The lyophilized protein powder should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, it is recommended to add 5-50% glycerol (with 50% being the standard final concentration) to the reconstituted protein before aliquoting and storing at -20°C/-80°C . When using the protein for experiments, brief centrifugation of the vial prior to opening is advised to bring contents to the bottom. For working stocks, aliquots can be maintained at 4°C for up to one week, but repeated freezing and thawing should be avoided as this can compromise protein integrity and activity .

What is the relationship between uspB expression and stress response in Vibrio cholerae?

The relationship between uspB expression and stress response in Vibrio cholerae follows the general pattern observed in Universal stress proteins, where environmental stressors trigger upregulation. When Vibrio cholerae encounters adverse conditions such as nutrient starvation, extreme temperatures, high salinity, or exposure to antibiotics, uspB gene expression increases significantly . This elevated expression results in higher amounts of uspB protein, which helps the bacterium cope with stress through mechanisms that may include altering the expression of various genes involved in stress response pathways. Similar to other USPs, uspB likely modifies cellular metabolism and physiology to enhance survival under unfavorable conditions . The specific regulatory pathways controlling uspB expression in V. cholerae have similarities to those documented in other bacteria, where stress-responsive transcription factors recognize promoter elements upstream of the uspB gene to initiate transcription in response to stress signals.

How does the ATP-binding capability of uspB affect its function in metabolic modulation?

The ATP-binding capability of uspB is likely central to its function in metabolic modulation, similar to what has been observed with other Universal stress proteins. Based on research with the mycobacterial USP Rv2624c, uspB probably functions in an ATP-dependent manner to influence metabolic pathways in Vibrio cholerae . When ATP binds to the uspB protein, it likely induces conformational changes that enable the protein to interact with various cellular components, including metabolic enzymes and regulatory proteins. This interaction may alter the activity of these proteins, thereby redirecting metabolic flux to pathways that enhance bacterial survival under stress conditions.

Studies with Rv2624c demonstrated that a mutant incapable of binding ATP lost its ability to confer growth advantages in human monocyte THP-1 cells, suggesting that nucleotide binding is essential for USP function . By analogy, uspB in V. cholerae may similarly modulate metabolite abundance, particularly of amino acids like arginine that serve as key cellular regulators. Arginine is particularly interesting as it functions as a modulator of both bacterial metabolism and host immune response . The ATP-binding property of uspB might enable it to sense the energy status of the cell and adjust metabolic parameters accordingly, potentially through:

• Allosteric regulation of metabolic enzymes

• Interaction with transcriptional regulators

• Modulation of transport systems for key metabolites

• Alteration of protein synthesis or degradation pathways

What experimental design is most appropriate for investigating uspB-knockout phenotypes in Vibrio cholerae?

For investigating uspB-knockout phenotypes in Vibrio cholerae, a factorial experimental design is most appropriate as it allows for the examination of multiple factors and their interactions simultaneously . This approach is particularly valuable given that USP functions are often redundant and context-dependent.

The experimental design should include the following components:

• Factor selection: Include multiple factors such as:

  • Genetic background (wild-type vs. uspB knockout)

  • Environmental stress conditions (temperature, pH, salinity, nutrient limitation)

  • Growth phase (log, stationary)

  • Presence of antimicrobial compounds

• Control for compensatory mechanisms: Since knockout of a USP gene is often compensated for by other universal stress proteins , include measurement of expression levels of other USP family members to assess potential compensatory upregulation.

• Measurement parameters: Assess multiple outputs including:

  • Growth rate and survival under various conditions

  • Metabolomic profiles (particularly arginine and related metabolites)

  • Global gene expression patterns (RNA-seq)

  • Protein-protein interactions

  • Virulence in cellular and animal infection models

• Randomized block design element: To control for batch effects or variations in experimental conditions, incorporate blocking by factors such as bacterial culture batch or experimental run .

• Complementation controls: Include genetic complementation experiments where the uspB gene is reintroduced to confirm that observed phenotypes are directly attributable to uspB deletion.

The factorial design allows for the analysis of not just the main effects of uspB knockout, but also how these effects might vary under different environmental conditions or genetic backgrounds, providing a more comprehensive understanding of uspB function within the complex regulatory networks of V. cholerae.

How does uspB contribute to Vibrio cholerae pathogenesis and host-pathogen interactions?

The contribution of uspB to Vibrio cholerae pathogenesis likely occurs through multiple mechanisms that influence both bacterial survival within the host and modulation of host immune responses. Based on studies of Universal stress proteins in other pathogenic bacteria, uspB may play significant roles in:

Understanding these mechanisms requires experiments that model the host-pathogen interface, such as infection studies in cell lines and animal models, combined with transcriptomic and metabolomic analyses to identify the specific pathways affected by uspB during infection.

What are the structural similarities and differences between uspB and other Universal stress proteins, and how do they relate to function?

Universal stress proteins share structural similarities centered around the conserved USP domain, but important differences exist that likely relate to their specialized functions. The uspB protein from Vibrio cholerae serotype O1 consists of 107 amino acids and contains the characteristic USP domain with the conserved G2×G9×GS motif . Based on comparative analysis with other USPs, the following structural features and their functional implications can be identified:

Unlike some larger USPs that contain multiple domains or tandem USP domain repeats, uspB from V. cholerae is relatively small with a single USP domain. This structural simplicity may reflect a more specialized function compared to larger multi-domain USPs that often have broader roles .

The ATP-binding capability is particularly important for function, as demonstrated with Rv2624c where mutation of the ATP-binding site abrogated its ability to confer growth advantages in host cells . Based on sequence analysis, uspB likely binds ATP in a manner similar to other characterized USPs, with the binding pocket formed by residues from the conserved motifs within the USP domain.

Understanding these structure-function relationships could guide the design of inhibitors targeting uspB as potential anti-virulence agents against V. cholerae.

How can transcriptome and metabolome analyses be integrated to understand uspB-mediated metabolic changes?

Integration of transcriptome and metabolome analyses provides a powerful approach to understanding uspB-mediated metabolic changes in Vibrio cholerae. This multi-omics strategy should be implemented as follows:

• Experimental design: Compare wild-type V. cholerae with uspB overexpression and knockout strains under both normal and stress conditions. Include time-course sampling to capture dynamic changes in response to stress induction .

• Transcriptome analysis: Use RNA sequencing to identify differentially expressed genes between the strains. Based on findings with other USPs, focus particularly on pathways involved in:

  • Histidine metabolism

  • Arginine and proline metabolism

  • Stress response pathways

  • Virulence factor expression

  • Energy production and conversion

• Metabolome analysis: Use LC-MS/MS to quantify metabolite abundances, with special attention to:

  • Arginine and related metabolites (ornithine, citrulline)

  • Histidine and histidine-derived compounds

  • Energy metabolites (ATP, ADP, AMP)

  • Other amino acids that might show altered abundance

• Integration strategies:

  • Pathway enrichment analysis: Map both transcriptomic and metabolomic changes to known metabolic pathways to identify concordantly altered pathways

  • Correlation network analysis: Construct networks connecting changes in gene expression with changes in metabolite levels

  • Flux balance analysis: Use transcriptomic data to constrain metabolic flux models and predict metabolite changes, then validate with measured metabolomics data

• Validation experiments:

  • Isotope labeling experiments to track flux through pathways identified in the multi-omics analysis

  • Targeted enzyme activity assays for key enzymes in implicated pathways

  • Genetic manipulation of identified pathway components to validate their role in uspB-mediated effects

This integrated approach would likely reveal that uspB affects metabolic flux through specific pathways, similar to how Rv2624c alters arginine abundance . The analysis might show that uspB acts as a metabolic switch in response to stress, redirecting resources away from growth-related processes toward survival mechanisms by coordinating transcriptional and metabolic changes.

What purification methods yield the highest activity for recombinant uspB protein?

For obtaining high-activity recombinant uspB protein from Vibrio cholerae serotype O1, a systematic purification protocol incorporating multiple chromatography steps is recommended. Based on established methods for similar proteins, the following procedure is advised:

• Expression system optimization:

  • Express the full-length uspB (1-107 amino acids) with an N-terminal His-tag in E. coli expression systems such as BL21(DE3)

  • Use a tightly controlled induction system (e.g., IPTG-inducible promoter) with induction at lower temperatures (16-18°C) to maximize proper folding

  • Consider codon optimization for E. coli if expression yields are low

• Cell lysis and initial clarification:

  • Use gentle lysis methods such as enzymatic lysis with lysozyme followed by mild sonication

  • Include protease inhibitors to prevent degradation

  • Clarify lysate by high-speed centrifugation (20,000 × g for 30 minutes)

• Multi-step chromatography:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with imidazole gradient elution

  • Intermediate purification: Ion exchange chromatography (typically anion exchange at pH 8.0)

  • Polishing step: Size exclusion chromatography to remove aggregates and ensure homogeneity

• Activity preservation measures:

  • Maintain reducing conditions throughout purification (1-5 mM DTT or 2-5 mM β-mercaptoethanol)

  • Include 10-20% glycerol in all buffers to enhance protein stability

  • Consider adding low concentrations of ATP (0.1-0.5 mM) to stabilize the protein's active conformation

  • Use Tris-based buffers at pH 8.0 as recommended for storage

• Quality control assessments:

  • SDS-PAGE analysis to confirm >90% purity

  • Western blot verification of identity

  • Circular dichroism to verify proper folding

  • Dynamic light scattering to assess aggregation state

  • Functional assays including ATP binding capability, as ATP binding is critical for USP function

The final product should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 as recommended , with aliquoting and flash freezing to minimize freeze-thaw cycles. Following reconstitution, adding glycerol to a final concentration of 5-50% is advised for long-term storage at -20°C/-80°C .

How can ATP-binding assays be optimized to study uspB nucleotide-binding properties?

Optimizing ATP-binding assays for studying uspB nucleotide-binding properties requires careful consideration of multiple parameters to ensure accurate and reproducible results. Based on studies with other Universal stress proteins like Rv2624c that demonstrate ATP-binding capabilities , the following approaches are recommended:

• Fluorescence-based assays:

  • TNP-ATP displacement assay: Use the fluorescent ATP analog 2',3'-O-(2,4,6-trinitrophenyl) adenosine 5'-triphosphate (TNP-ATP) which increases fluorescence upon protein binding. Competition with unlabeled ATP can determine binding affinity.

  • Intrinsic tryptophan fluorescence: If uspB contains tryptophan residues near the ATP-binding site, monitor changes in tryptophan fluorescence upon ATP binding.

• Isothermal Titration Calorimetry (ITC):

  • Offers direct measurement of binding constants, stoichiometry, and thermodynamic parameters

  • Optimization parameters:

    • Protein concentration: 10-50 μM in cell

    • ATP concentration: 100-500 μM in syringe

    • Buffer conditions: 20 mM Tris-HCl pH 8.0, 150 mM NaCl, 5 mM MgCl₂ (Mg²⁺ is essential for proper ATP binding)

    • Temperature: 25°C with careful temperature equilibration

• Surface Plasmon Resonance (SPR):

  • Immobilize His-tagged uspB on Ni-NTA sensor chips

  • Flow different concentrations of ATP over the surface

  • Analyze association and dissociation rates to determine binding kinetics

• Filter binding assays:

  • Use radiolabeled [γ-³²P]ATP or [α-³²P]ATP

  • Incubate with uspB protein under various conditions

  • Separate bound from free nucleotide using nitrocellulose filters

  • Quantify retained radioactivity to determine binding

• Critical assay optimization parameters:

  • Divalent cation concentration: Systematically vary Mg²⁺ or Mn²⁺ concentrations (1-10 mM)

  • pH optimization: Test range from pH 6.5-8.5

  • Salt concentration: Test binding at different ionic strengths (50-300 mM NaCl)

  • Temperature dependence: Perform assays at 4°C, 25°C, and 37°C

  • Competitive binding: Test specificity using other nucleotides (GTP, CTP, UTP)

• Control experiments:

  • Generate a mutant uspB with substitutions in predicted ATP-binding residues (based on alignment with Rv2624c or other characterized USPs)

  • Verify that heat-denatured protein loses binding capacity

  • Include appropriate positive controls (known ATP-binding proteins) and negative controls

• Data analysis:

  • Fit binding data to appropriate models (one-site, two-site, cooperative binding)

  • Determine binding constants (Kd), stoichiometry, and thermodynamic parameters

  • Compare with other USP family members to identify unique features of uspB binding properties

These optimized assays would allow for detailed characterization of uspB nucleotide-binding properties, providing insights into how ATP binding influences its function in stress response and bacterial survival.

What cell culture models are most appropriate for studying uspB effects on host-pathogen interactions?

For studying uspB effects on host-pathogen interactions, several cell culture models offer complementary advantages that collectively provide comprehensive insights into Vibrio cholerae pathogenesis. Based on research with other Universal stress proteins and V. cholerae pathogenesis studies , the following models are recommended:

• Intestinal epithelial cell lines:

  • Caco-2 cells: These human colorectal adenocarcinoma cells differentiate to form polarized epithelial monolayers with tight junctions, microvilli, and enterocyte-like properties when grown to confluence. They are ideal for:

    • Studying bacterial adhesion and invasion

    • Measuring epithelial barrier integrity via transepithelial electrical resistance (TEER)

    • Assessing secretion of inflammatory mediators

    • Protocol considerations: Culture for 14-21 days post-confluence for full differentiation; use transwells for polarized monolayers

  • T84 cells: Human colorectal carcinoma cells that form tight epithelial barriers, useful for:

    • Chloride secretion studies (relevant to cholera toxin effects)

    • Complement Caco-2 data with a different intestinal cell type

• Immune cell models:

  • THP-1 monocytes: Human monocytic cell line shown to be valuable in studying USP effects in other bacterial systems . Useful for:

    • Phagocytosis assays

    • Intracellular survival assessment

    • Cytokine production measurement

    • Comparing wild-type vs. uspB-deficient V. cholerae survival

    • Protocol considerations: Use PMA-differentiated THP-1 cells to model macrophages; compare results in both activated and non-activated states

  • Primary human peripheral blood mononuclear cells (PBMCs): Provide a more physiologically relevant immune cell model:

    • Include multiple immune cell types

    • Donor variability can be addressed through biological replicates

• Co-culture systems:

  • Epithelial-immune cell co-cultures: Combine Caco-2 cells with THP-1-derived macrophages to model epithelial-immune cell interactions during infection

  • Protocol considerations: Culture Caco-2 cells on transwell inserts with immune cells in the basolateral compartment

• Three-dimensional models:

  • Intestinal organoids: Primary stem cell-derived 3D cultures that better recapitulate intestinal tissue:

    • Contain multiple intestinal cell types

    • Exhibit physiological polarity and organization

    • Protocol considerations: Use microinjection techniques to introduce bacteria into the lumen

• Experimental parameters to assess:

  • Bacterial adherence and invasion (CFU assays, confocal microscopy)

  • Host cell viability (MTT assay, LDH release)

  • Cytokine/chemokine production (ELISA, multiplex bead arrays)

  • Gene expression changes in host cells (qRT-PCR, RNA-seq)

  • Intracellular survival kinetics

  • Effects on epithelial barrier function

• Comparative experimental design:

  • Compare wild-type V. cholerae to uspB knockout strains

  • Include complemented strains (uspB knockout with plasmid-expressed uspB)

  • Test ATP-binding mutants of uspB based on findings with Rv2624c

  • Examine effects under various stress conditions

This comprehensive approach using multiple cell models allows for robust characterization of uspB's role in host-pathogen interactions, with THP-1 cells being particularly relevant based on previous USP research and intestinal epithelial models being most physiologically relevant to cholera pathogenesis .

What analytical techniques provide the most comprehensive assessment of metabolic changes induced by uspB?

To comprehensively assess metabolic changes induced by uspB in Vibrio cholerae, a multi-platform analytical approach is required to capture the full spectrum of metabolic alterations. Based on research with other Universal stress proteins that demonstrated effects on metabolite abundance , the following techniques and experimental design are recommended:

• Untargeted Metabolomics:

  • Liquid Chromatography-Mass Spectrometry (LC-MS):

    • HILIC chromatography for polar metabolites (amino acids, nucleotides, sugar phosphates)

    • Reverse-phase chromatography for lipids and less polar compounds

    • High-resolution MS (Q-TOF or Orbitrap) for accurate mass determination

    • MS/MS fragmentation for structural confirmation

  • Gas Chromatography-Mass Spectrometry (GC-MS):

    • Complements LC-MS by detecting volatile compounds and those requiring derivatization

    • Particularly valuable for TCA cycle intermediates, fatty acids, and some amino acids

    • Provides robust quantification through well-established libraries

• Targeted Metabolomics:

  • Triple Quadrupole LC-MS/MS:

    • Focused analysis of arginine and related metabolites (ornithine, citrulline) based on findings with Rv2624c

    • Targeted analysis of nucleotides (ATP, ADP, AMP, GTP) to assess energy status

    • Multiple Reaction Monitoring (MRM) for high sensitivity and specificity

• Flux Analysis:

  • 13C-labeled substrate experiments:

    • Feed bacteria with 13C-labeled glucose or other carbon sources

    • Track isotope incorporation into metabolic intermediates

    • Determine metabolic flux changes induced by uspB

    • Analysis using LC-MS or NMR to detect isotopomers

• Nuclear Magnetic Resonance (NMR) Spectroscopy:

  • 1H-NMR for metabolite profiling

  • 31P-NMR for phosphorylated metabolites

  • Time-course experiments to monitor real-time metabolic changes

• Experimental Design Considerations:

  • Sampling protocol optimization:

    • Rapid quenching of metabolism (cold methanol at -40°C)

    • Efficient extraction methods for different metabolite classes

    • Multiple biological and technical replicates

  • Comparison groups:

    • Wild-type V. cholerae vs. uspB knockout strains

    • uspB overexpression strains

    • ATP-binding deficient uspB mutants

    • Samples collected under normal and stress conditions

    • Time-course sampling to capture dynamic changes

• Data Integration and Analysis:

  • Multivariate statistical methods (PCA, PLS-DA) to identify patterns

  • Pathway enrichment analysis using KEGG and MetaCyc databases

  • Integration with transcriptomic data to correlate gene expression with metabolite changes

  • Network analysis to identify metabolic hubs affected by uspB

• Validation Approaches:

  • Enzyme activity assays for key metabolic enzymes identified in pathway analysis

  • Targeted gene knockouts of affected pathways to confirm mechanistic links

  • In vitro enzyme assays with purified uspB to test direct effects on metabolic enzymes

This comprehensive analytical approach would likely reveal that uspB affects specific metabolic pathways, particularly those involving arginine metabolism, similar to findings with other USPs . The combination of untargeted discovery with targeted validation provides the most robust assessment of uspB-induced metabolic changes.

How can understanding uspB function contribute to developing new anti-Vibrio cholerae strategies?

Understanding the function of uspB in Vibrio cholerae can significantly contribute to the development of novel anti-Vibrio cholerae strategies through multiple avenues. The targeting of stress response systems represents an emerging approach in antimicrobial development that may be less prone to resistance development. Based on our understanding of Universal stress proteins and V. cholerae pathogenesis , the following strategies can be envisioned:

• Direct inhibition of uspB activity:

  • Small molecule inhibitors targeting the ATP-binding site of uspB could prevent its function during stress, potentially reducing bacterial survival in the host environment

  • Structure-based drug design using the amino acid sequence information and homology modeling based on known USP structures could identify potential binding pockets

  • High-throughput screening of compound libraries against purified recombinant uspB could identify lead compounds

• Disruption of uspB-dependent metabolic adaptation:

  • Targeting the specific metabolic pathways modified by uspB, particularly arginine metabolism which has been implicated in USP function

  • Developing compounds that counteract the metabolic changes induced by uspB during infection

  • Combination therapies that both target uspB and the metabolic adaptations it induces

• Vaccine development:

  • If uspB is surface-exposed or secreted during infection, it could serve as an antigen in vaccine formulations

  • Even if not directly accessible, understanding uspB-regulated genes could identify potential vaccine targets that are expressed during infection

• Biomarker applications:

  • uspB expression levels or the metabolic changes it induces could serve as biomarkers for V. cholerae stress states

  • This could inform diagnostic approaches to detect actively replicating versus stressed bacteria

• Host-directed therapies:

  • If uspB modulates host cell responses similar to other USPs , therapeutic strategies could target the host pathways affected

  • For example, if uspB alters arginine metabolism in host cells, arginine supplementation or modulation could counteract these effects

• Combination therapy design:

  • Understanding how uspB contributes to stress resistance could inform the design of more effective combination therapies

  • For example, a uspB inhibitor could be combined with conventional antibiotics to prevent the stress response that might otherwise protect bacteria during treatment

• Probiotic approaches:

  • Engineering beneficial bacteria to express inhibitors of uspB function

  • Using knowledge of uspB-regulated pathways to design probiotic strains that could outcompete V. cholerae by exploiting metabolic vulnerabilities

A promising research direction would be to develop small molecules that specifically inhibit the ATP-binding capability of uspB, as research with Rv2624c demonstrated that ATP binding is essential for USP function in enhancing bacterial survival in host cells . Such inhibitors would potentially reduce V. cholerae survival during infection without directly killing the bacteria, potentially reducing selection pressure for resistance development.

How can site-directed mutagenesis be used to identify critical residues for uspB function?

Site-directed mutagenesis represents a powerful approach for identifying critical residues for uspB function in Vibrio cholerae. Based on the understanding of Universal stress proteins and nucleotide-binding proteins , a systematic mutagenesis strategy should target the following:

• ATP-binding site residues:

  • Conserved glycine residues in the G2×G9×GS motif characteristic of USPs should be primary targets

  • Based on findings with Rv2624c, mutations in ATP-binding residues abrogated function in enhancing survival in host cells

  • Specific mutations to consider:

    • Glycine to alanine substitutions in the conserved motif

    • Mutations of predicted ATP-binding residues identified through sequence alignment with characterized USPs

    • Conservative and non-conservative substitutions to assess the importance of specific chemical properties

• Predicted dimerization interface:

  • Many USPs function as dimers, so residues at potential dimerization interfaces should be targeted

  • Hydrophobic residues often mediate protein-protein interactions and are good candidates

• Putative membrane interaction regions:

  • The amino acid sequence of uspB contains hydrophobic stretches that may facilitate membrane localization

  • Mutations altering the hydrophobicity of these regions could reveal their importance for localization and function

• Experimental approach:

  • Generate a library of point mutations using PCR-based site-directed mutagenesis

  • Express mutant proteins in E. coli for purification and biochemical characterization

  • Complement uspB knockout V. cholerae with plasmids expressing mutant versions

  • Test each mutant for:

    • ATP binding capability (using optimized binding assays)

    • Protein stability and folding (circular dichroism, thermal shift assays)

    • Oligomerization state (size exclusion chromatography, native PAGE)

    • Functional activities:

      • Stress resistance (survival under various stress conditions)

      • Metabolite modulation (targeted metabolomics focusing on arginine)

      • Survival in host cell models (particularly THP-1 cells)

• Systematic scanning mutagenesis:

  • For regions without clear functional predictions, alanine scanning mutagenesis can systematically replace each residue with alanine

  • Charged residue scanning can identify regions involved in electrostatic interactions

• Structure-guided approach:

  • Use homology modeling based on known USP structures to predict functionally important residues

  • Focus on conserved residues in predicted functional sites

  • Use molecular dynamics simulations to identify residues that may move during conformational changes

• Analysis framework:

  • Categorize mutations based on their effects:

    • Class I: Complete loss of function (critical residues)

    • Class II: Partial loss of function (contributing residues)

    • Class III: No effect on function (non-essential residues)

    • Class IV: Enhanced function (regulatory residues)

  • Correlate functional defects with biochemical properties to establish structure-function relationships

This systematic mutagenesis approach would likely reveal that, similar to Rv2624c, uspB function depends critically on ATP binding, with mutations in the nucleotide-binding pocket abolishing its role in stress response and metabolic modulation . The results would provide a detailed map of functional residues in uspB, informing both fundamental understanding and potential therapeutic targeting.

What comparative genomics approaches can reveal about uspB evolution across Vibrio species?

Comparative genomics approaches can provide significant insights into uspB evolution across Vibrio species, revealing patterns of conservation, adaptation, and potential functional specialization. Based on our understanding of Universal stress proteins across different organisms , the following comprehensive approach is recommended:

• Sequence-based analyses:

  • Phylogenetic analysis:

    • Construct phylogenetic trees using uspB homologs from diverse Vibrio species

    • Compare uspB phylogeny with species phylogeny to identify potential horizontal gene transfer events

    • Examine branch lengths to assess evolutionary rates in different lineages

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify sites under positive, neutral, or purifying selection

    • Use methods such as PAML, SLAC, FEL, and MEME to detect episodic selection

    • Map selection patterns onto protein structure models to identify functional domains under different selection pressures

  • Conservation mapping:

    • Quantify residue conservation across Vibrio uspB homologs

    • Identify highly conserved residues likely essential for function (including the G2×G9×GS motif)

    • Detect lineage-specific conserved residues that may indicate specialized functions

• Synteny and genomic context analysis:

  • Examine gene neighborhoods around uspB across Vibrio species

  • Identify conserved operonic structures or gene clusters

  • Detect co-evolved gene pairs that may indicate functional relationships

  • Compare with non-Vibrio species to identify Vibrio-specific patterns

• Structural prediction and comparison:

  • Generate structural models of uspB proteins from different Vibrio species

  • Compare predicted ATP-binding sites and potential interaction surfaces

  • Identify structural variations that may relate to functional differences

  • Correlate structural features with habitat and lifestyle of different Vibrio species

• Correlation with ecological niches:

  • Group uspB sequences according to the ecological niches of source organisms

  • Identify potential adaptive signatures associated with:

    • Host specificity (human pathogenic vs. marine animal-associated Vibrios)

    • Environmental adaptation (freshwater vs. marine vs. estuarine species)

    • Geographic distribution patterns

  • Correlate uspB sequence features with virulence potential across species

• Co-evolution network analysis:

  • Identify proteins that co-evolve with uspB using methods such as mutual information analysis

  • Construct protein interaction networks based on co-evolution patterns

  • Compare these networks across Vibrio species to identify conserved and species-specific interactions

• Experimental validation:

  • Heterologous expression of uspB variants from different Vibrio species in V. cholerae uspB knockout

  • Test complementation efficiency under various stress conditions

  • Assess ATP-binding properties of different uspB homologs

  • Evaluate effects on metabolite profiles, particularly arginine levels

• Data integration and visualization:

  • Integrate findings using genome visualization tools

  • Create comprehensive maps of uspB evolution across the Vibrio genus

  • Develop models explaining the evolutionary history and adaptive significance of uspB

This comprehensive approach would likely reveal that uspB has evolved under different selective pressures across Vibrio species, with core functions related to stress response being conserved while specific adaptations related to particular ecological niches showing greater variability. The results would provide insights into how uspB contributes to the adaptation of different Vibrio species to their specific environmental challenges and host interactions.

What are the major research gaps in understanding uspB function in Vibrio cholerae?

Despite the accumulating knowledge about Universal stress proteins in bacteria, significant research gaps remain in our understanding of uspB function specifically in Vibrio cholerae. Based on the current state of research on USPs and V. cholerae pathogenesis , the following represent critical knowledge gaps that warrant further investigation:

• Regulatory networks controlling uspB expression: While USPs are known to be induced by various stressors , the specific transcriptional and post-transcriptional regulatory mechanisms controlling uspB expression in V. cholerae remain poorly characterized. Understanding these regulatory networks would provide insights into how uspB integrates into the broader stress response system of V. cholerae.

• Exact biochemical activity and molecular mechanism: Unlike some proteins with clear enzymatic functions, the precise biochemical activity of uspB remains undefined. While ATP binding has been established as important for USP function , the exact molecular consequences of this nucleotide binding and how it translates to cellular effects are still unclear for uspB in V. cholerae.

• Protein interaction partners: The proteins that directly interact with uspB in V. cholerae have not been comprehensively identified. These interaction partners are likely crucial for understanding how uspB exerts its effects on cellular physiology and stress resistance.

• Role in biofilm formation and persistence: Given that some USPs influence adhesion and motility in other bacteria , uspB may play a role in V. cholerae biofilm formation and environmental persistence, but this potential function remains largely unexplored.

• Contribution to cholera pathogenesis in vivo: While in vitro studies with other USPs suggest roles in host-pathogen interactions , the specific contribution of uspB to V. cholerae pathogenesis in relevant animal models of cholera has not been thoroughly investigated.

• Metabolic rewiring mechanisms: Although USPs like Rv2624c affect metabolite abundance , the comprehensive metabolic changes induced by uspB and the mechanisms by which it rewires bacterial metabolism during stress remain to be fully elucidated.

• Potential as therapeutic target: The feasibility of targeting uspB for therapeutic intervention against V. cholerae has not been systematically evaluated, including assessments of its essentiality under relevant conditions and the druggability of its ATP-binding pocket.

• Coordination with other stress response systems: How uspB functions coordinate with other stress response systems in V. cholerae, such as the SOS response, oxidative stress response, and stringent response, remains poorly understood.

• Structural determinants of function: The three-dimensional structure of uspB from V. cholerae has not been experimentally determined, limiting our understanding of structure-function relationships and rational design of inhibitors.

Addressing these research gaps would significantly advance our understanding of uspB function in V. cholerae and potentially inform the development of novel strategies to combat cholera, a disease that continues to affect millions worldwide each year .

What integrated research approaches would most effectively advance understanding of uspB in future studies?

To most effectively advance our understanding of uspB in Vibrio cholerae, future studies should adopt integrated research approaches that combine multiple methodologies and perspectives. Based on current knowledge of Universal stress proteins and experimental approaches in bacterial pathogenesis research , the following integrated strategy is recommended:

• Multi-omics integration:

  • Combine transcriptomics, proteomics, and metabolomics data from uspB knockout and overexpression strains

  • Apply network analysis and machine learning approaches to identify emergent patterns

  • Use time-course experiments to capture dynamic changes following stress exposure

  • Integrate findings with existing databases of bacterial stress responses

• Structural biology and molecular dynamics:

  • Determine the three-dimensional structure of uspB using X-ray crystallography or cryo-EM

  • Perform molecular dynamics simulations to understand conformational changes upon ATP binding

  • Use hydrogen-deuterium exchange mass spectrometry to identify regions undergoing structural changes

  • Apply this structural knowledge to guide focused mutagenesis studies

• Systems biology approaches:

  • Develop mathematical models of uspB-influenced metabolic networks

  • Use genome-scale metabolic models to predict the effects of uspB perturbation

  • Apply flux balance analysis to identify metabolic vulnerabilities

  • Validate model predictions with targeted experimental approaches

• Advanced genetic approaches:

  • Apply CRISPR interference for titratable gene expression instead of binary knockout/overexpression

  • Use synthetic genetic array analysis to identify genetic interactions with uspB

  • Develop reporter systems to monitor uspB expression in real-time during infection

  • Apply site-saturation mutagenesis for comprehensive functional mapping

• Host-pathogen interface studies:

  • Use advanced tissue culture models including intestinal organoids and organ-on-a-chip systems

  • Apply single-cell RNA-seq to identify heterogeneous responses to V. cholerae expressing different levels of uspB

  • Develop in vivo imaging approaches to track uspB expression during infection

  • Examine host metabolic changes in response to wild-type versus uspB-deficient V. cholerae

• Translational research integration:

  • Screen for small molecule modulators of uspB activity

  • Evaluate combination approaches targeting uspB alongside conventional antibiotics

  • Assess the impact of uspB inhibition on V. cholerae transmission dynamics

  • Develop diagnostic approaches based on uspB expression or activity

• Ecological and evolutionary perspectives:

  • Study uspB function in environmental V. cholerae isolates from diverse sources

  • Examine uspB expression during transitions between environmental reservoirs and human hosts

  • Investigate the role of uspB in interactions with aquatic organisms and predators

  • Apply experimental evolution to understand uspB adaptation under various selective pressures

• Collaborative research networks:

  • Establish interdisciplinary teams combining expertise in:

    • Structural biology and biophysics

    • Bacterial genetics and molecular biology

    • Immunology and host-pathogen interactions

    • Computational biology and systems modeling

    • Medicinal chemistry and drug development

  • Develop standardized protocols for uspB research to facilitate data comparison across laboratories