Recombinant Vibrio cholerae serotype O1 UPF0208 membrane protein VC_1099 (VC_1099)

Protein Characteristics and Structure

VC_1099 is a membrane protein from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961), classified as an UPF0208 family protein. The protein consists of 150 amino acid residues with a sequence beginning with MNNKVGIVHSLKDGQKYMDIWPMRKELNPLFPEQRVIKATRFAIKVMPAVAAISVLTQMVFANTQAMPQAIVVALFAMSLPLQGIWWLGHRANTQLPPALASWYRELYMKIVETGFALEPIKSKPRYKELAQVLNRAFRQLDDTALERWF . The protein is accessible through UniProt database with accession number Q9KT06 .

Functional Context in Vibrio cholerae Biology

Understanding VC_1099 requires context within V. cholerae membrane biology. As a gram-negative pathogen, V. cholerae relies on its membrane proteins for critical functions including environmental adaptation, dormancy responses, and host-pathogen interactions . While the specific function of VC_1099 is not fully characterized in the available literature, its classification as a membrane protein suggests potential roles in cellular processes relevant to V. cholerae pathogenicity and survival.

What is the predicted structural topology of VC_1099 membrane protein?

Based on sequence analysis and comparison with other UPF0208 family proteins, VC_1099 likely adopts a transmembrane configuration with multiple membrane-spanning domains. The hydrophobic regions within the sequence (particularly IVVALFAMSLPLQGIWWLGHR) suggest transmembrane helices that anchor the protein within the bacterial membrane . Using vesicle-based structural studies, as demonstrated for other membrane proteins, could help determine if VC_1099 spans the inner or outer membrane of V. cholerae .

For reliable structural prediction, researchers should:

• Perform in silico transmembrane domain prediction using multiple algorithms

• Compare predictions with experimentally determined structures of homologous proteins

• Validate topology models using biochemical approaches such as cysteine accessibility studies

How does VC_1099 expression vary across V. cholerae growth phases?

Expression patterns of membrane proteins often correlate with bacterial adaptation to environmental conditions. While specific expression data for VC_1099 is limited in the available literature, researchers investigating this question should:

• Design qRT-PCR assays targeting VC_1099 mRNA across growth phases

• Use western blotting with anti-VC_1099 antibodies to quantify protein levels

• Consider reporter gene fusions to monitor expression in real-time

Based on research on other V. cholerae membrane proteins, expression may vary significantly between exponential growth, stationary phase, and dormancy states . Particularly, expression might be upregulated in response to environmental stresses that trigger dormancy, such as exposure to L-Arabinose, cold stress, or cell wall-targeting antibiotics .

What purification approaches yield optimal recovery of functional VC_1099?

Purification of membrane proteins remains challenging due to their hydrophobic nature and requirement for membrane mimetics. For VC_1099, researchers should consider:

• Detergent screening to identify optimal solubilization conditions

• Vesicle-based isolation methods to maintain the native lipid environment

• Affinity purification utilizing recombinant tags

A promising approach involves vesicle-based methods that enable membrane protein structure determination in their native lipid environment, bypassing detergent solubilization limitations . This method has been successfully used for the multidrug efflux transporter AcrB, revealing structural differences compared to detergent-solubilized preparations .

How might VC_1099 contribute to V. cholerae phage resistance mechanisms?

Membrane proteins can serve as phage receptors or components of resistance mechanisms. For instance, the outer-membrane protein TolC of V. cholerae serves as a receptor for phage infection . Researchers investigating VC_1099's potential role in phage interactions should:

• Generate VC_1099 knockout strains and assess susceptibility to various phages

• Examine sequence variations in VC_1099 across phage-resistant and sensitive strains

• Perform direct binding assays between purified VC_1099 and phage components

Mutations in membrane protein loops exposed to the cell surface have been observed in phage-resistant V. cholerae strains . Similar mutations in VC_1099, particularly in surface-exposed regions, could potentially alter phage binding and infection efficiency.

What interactions exist between VC_1099 and the host immune system during infection?

Understanding if VC_1099 elicits specific immune responses could provide insights into host-pathogen interactions. Research approaches should include:

• Analysis of antibody responses against VC_1099 in infected or vaccinated individuals

• Evaluation of VC_1099's potential as a diagnostic marker or vaccine component

• Assessment of VC_1099's ability to modulate immune signaling pathways

Systems serology studies have identified multiple antibody biomarkers associated with protection against V. cholerae infection . Determining if anti-VC_1099 antibodies contribute to this protection could reveal important insights into cholera immunity. Researchers could examine whether serum antibody-dependent complement deposition, which has been identified as a predictive correlate of protection from V. cholerae infection, targets VC_1099 .

How does VC_1099 function change during dormancy states of V. cholerae?

V. cholerae can enter dormant states in response to environmental stresses, with significant physiological changes . For VC_1099 research in this context:

• Compare protein expression and modification between active and dormant cells

• Investigate potential structural rearrangements during dormancy

• Assess functional changes using reconstituted systems

Recent research has demonstrated that L-Arabinose can induce dormancy in V. cholerae, offering a straightforward experimental model . This system could be leveraged to study VC_1099 dynamics during transitions between active growth and dormancy states, potentially revealing new functions during stress adaptation.

Structural Characterization Techniques for VC_1099

For reliable structural studies of VC_1099, researchers should consider multiple complementary approaches:

• Cryo-electron microscopy of vesicle-embedded VC_1099

  • Advantage: Maintains native lipid environment

  • Challenge: Requires optimization of vesicle preparation

  • Notable finding: Studies with other membrane proteins have revealed structural differences between vesicle-embedded and detergent-solubilized conformations

• NMR spectroscopy for dynamic structural elements

  • Advantage: Provides information on protein dynamics

  • Challenge: Requires isotope labeling and significant protein quantities

  • Application: Can reveal conformational changes related to function

• Computational structural prediction and molecular dynamics

  • Advantage: Provides initial structural hypotheses

  • Challenge: Requires experimental validation

  • Implementation: Combined with limited experimental constraints can yield reliable models

Functional Assays for Membrane Protein VC_1099

Functional characterization of VC_1099 requires specialized approaches:

• Reconstitution into proteoliposomes for transport assays

  • Methodology: Incorporate purified VC_1099 into artificial liposomes

  • Measurements: Assess substrate transport using fluorescent reporters

  • Controls: Include inactive mutants and inhibitor studies

• Bacterial two-hybrid analysis for protein interaction mapping

  • Application: Identify interaction partners within the bacterial membrane

  • Advantage: Works in vivo under physiological conditions

  • Limitation: May miss transient or weak interactions

• Site-directed mutagenesis for structure-function relationships

  • Target residues: Focus on conserved regions and predicted functional domains

  • Readouts: Growth phenotypes, stress resistance, membrane integrity

  • Analysis: Correlate functional changes with structural elements

Optimizing Recombinant Expression of VC_1099

Producing sufficient quantities of functional VC_1099 for research presents unique challenges:

• Expression system selection criteria

  • E. coli-based systems: BL21(DE3), C41/C43 specialized for membrane proteins

  • Cell-free systems: Avoid cellular toxicity issues

  • Native V. cholerae expression: Maintains natural folding environment

• Solubilization and stabilization strategies

  • Detergent screening: Test multiple detergent classes (maltoside, glucoside, fos-choline)

  • Lipid supplementation: Include native V. cholerae lipids for stability

  • Additive screening: Identify buffer components that enhance stability

• Quality control assessments

  • Size-exclusion chromatography: Verify monodispersity

  • Circular dichroism: Confirm secondary structure integrity

  • Thermal stability assays: Measure protein stability under various conditions

Emerging Research Areas for VC_1099

As research on V. cholerae membrane proteins advances, several promising directions for VC_1099 investigation emerge:

• Integration of VC_1099 studies with dormancy research may reveal novel survival mechanisms for V. cholerae in adverse environments .

• Exploration of VC_1099's potential interactions with host immune components could provide insights into V. cholerae pathogenesis and protection .

• Implementation of vesicle-based structural methods represents a significant opportunity to understand VC_1099 structure in its native environment .