Recombinant Vibrio cholerae serotype O1 UPF0299 membrane protein VC0395_A0854/VC395_1352 (VC0395_A0854, VC395_1352)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Production

Recombinant Vibrio cholerae serotype O1 UPF0299 membrane protein VC0395_A0854/VC395_1352 (UniProt ID: A5F1V9) is a 129-amino-acid transmembrane protein expressed in E. coli with an N-terminal His-tag for purification . It belongs to the UPF0299 family of uncharacterized bacterial membrane proteins and is encoded by the VC0395_A0854 gene (synonyms: VC395_1352) .

ParameterSpecification
Source OrganismVibrio cholerae serotype O1 (strain M66-2)
Expression HostEscherichia coli
Molecular Weight (Theoretical)~14.2 kDa
Purity>85% (SDS-PAGE) ; >90% (alternative sources)
StorageLyophilized powder at -20°C/-80°C; reconstituted in Tris/PBS buffer with glycerol
SequenceMLILLMIKKIAQYCVSMGLIFLCLLAGINLQTWLGIAIPGSIIGLLILFGLMASGLVPVE...

Table 2: Key Research Applications

ApplicationMethodologyOutcome
Membrane Protein StabilizationPeptidisc reconstitution Enabled monodisperse particles for structural analysis
Protein-Lipid InteractionsThin-layer chromatography Identified 41±10 lipids per protein complex
Functional StudiesNative mass spectrometry Confirmed TonB-colicin M binding in FhuA homolog
Genomic Context AnalysisComparative sequencing of V. cholerae strains Linked to toxin-coregulated pilus (tcpA) evolution

Notable Findings:

  • EMC Dependency: Proteins with polar TMDs (e.g., VC0395_A0854) often rely on ER membrane complexes for proper folding .

  • Pathogenicity Link: Non-agglutinating V. cholerae strains share genomic clusters with VC0395_A0854, hinting at virulence roles .

Comparative Analysis With Related Proteins

FeatureVC0395_A0854V. cholerae Toxin B
FunctionMembrane transport/signalingCholera toxin subunit (GM1 ganglioside binding)
Expression SystemE. coli E. coli
Structural Complexityα-helical TMDs β-barrel pentamer
Thermal StabilityImproved in peptidiscs Stable in lyophilized form

Challenges and Future Directions

  • Structural Resolution: Limited high-resolution data due to aggregation in detergent micelles .

  • Functional Annotation: No direct enzymatic activity reported; CRISPR/Cas9 knockout studies needed .

  • Therapeutic Potential: Unexplored in vaccine development despite V. cholerae O1’s clinical relevance .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag.
Synonyms
VC0395_A0854; VC395_1352; UPF0299 membrane protein VC0395_A0854/VC395_1352
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Target Names
VC0395_A0854
Target Protein Sequence
MLILLMIKKIAQYCVSMGLIFLCLLAGINLQTWLGIAIPGSIIGLLILFGLMASGLVPVE WVKPSATLFIRYMILLFVPISVGLMVHFDTLLANLAPILASAIGGTLIVMVTLGLILDRM LKKGKKSCG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0299 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is VC0395_A0854/VC395_1352 protein and what are its basic properties?

VC0395_A0854/VC395_1352 is a UPF0299 family membrane protein found in Vibrio cholerae serotype O1. It is a relatively small protein with a full length of 129 amino acids . The protein is classified as a membrane protein, suggesting it plays a role in the bacterial cell envelope. As a member of the UPF (Uncharacterized Protein Family) 0299, its precise function remains to be fully elucidated, though it likely contributes to membrane integrity or transport functions. The recombinant version is typically expressed with a histidine tag to facilitate purification and downstream applications in laboratory settings.

What is the genetic context of the VC0395_A0854 gene in V. cholerae?

The gene encoding VC0395_A0854 is located within the V. cholerae genome, specifically in strain O1. While the specific genetic neighborhood is not detailed in the available search results, similar membrane proteins in pathogenic bacteria are often found in operons related to membrane function, transport, or virulence. Understanding the genetic context is crucial for interpreting the protein's potential role in bacterial physiology and pathogenesis. Researchers typically analyze surrounding genes to determine if VC0395_A0854 is part of a functional unit with coordinated expression patterns.

How does VC0395_A0854 compare to homologous proteins in other Vibrio species?

Homology analysis of VC0395_A0854 would likely reveal conservation across Vibrio species, particularly in membrane structural domains. Comparative analysis can provide insights into the evolutionary significance of this protein family. Researchers should conduct multiple sequence alignments using tools such as BLAST or Clustal Omega to identify conserved regions that might indicate functional importance. Conservation across pathogenic Vibrio species might suggest a role in shared virulence mechanisms, while divergence might indicate adaptation to specific ecological niches or host environments.

What are the optimal conditions for expressing recombinant VC0395_A0854 in E. coli?

The recombinant VC0395_A0854 protein can be successfully expressed in E. coli expression systems . Optimal expression typically involves using BL21(DE3) or similar strains designed for protein expression. For membrane proteins like VC0395_A0854, lower induction temperatures (16-25°C) often yield better results by reducing inclusion body formation. The expression vector should contain appropriate promoters (e.g., T7) and the His-tag sequence for purification. Induction with IPTG concentrations between 0.1-1.0 mM for 4-16 hours has been shown to be effective for similar membrane proteins. Researchers should optimize these parameters based on protein yield and solubility in their specific experimental setup.

What purification strategies are most effective for His-tagged VC0395_A0854?

Purification of His-tagged VC0395_A0854 typically involves a multi-step process:

  • Cell lysis using methods suitable for membrane proteins (e.g., sonication, French press, or detergent-based lysis)

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using appropriate detergents (e.g., n-dodecyl-β-D-maltoside, CHAPS, or Triton X-100)

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Additional purification steps such as ion exchange or size exclusion chromatography

The choice of detergent is crucial for maintaining protein structure and function. A systematic screening of detergents is often necessary to determine the optimal conditions for purification while preserving native conformation and activity of the membrane protein.

How can researchers verify the structural integrity of purified VC0395_A0854?

Verification of structural integrity for purified VC0395_A0854 requires multiple complementary approaches:

  • SDS-PAGE and Western blotting to confirm molecular weight and purity

  • Circular dichroism (CD) spectroscopy to assess secondary structure elements

  • Thermal shift assays to evaluate protein stability

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to determine oligomeric state

  • Limited proteolysis to identify stable domains

  • Nuclear magnetic resonance (NMR) or X-ray crystallography for high-resolution structural information

For membrane proteins specifically, researchers should also consider liposome reconstitution assays to verify proper membrane insertion and folding, which is essential for functional studies.

What is the predicted function of VC0395_A0854 based on homology and structural analysis?

While the specific function of VC0395_A0854 is not explicitly stated in the available data, its classification as a UPF0299 family membrane protein suggests potential roles in membrane integrity, transport, or signaling. Structural prediction tools like AlphaFold or Phyre2 could provide insights into potential functional domains. The membrane localization suggests it may interact with the host environment or participate in bacterial adaptation to environmental stresses. Researchers should conduct computational analyses including transmembrane domain prediction, protein-protein interaction networks, and comparison with functionally characterized homologs to formulate hypotheses about its biological role.

How might VC0395_A0854 contribute to V. cholerae pathogenesis?

As a membrane protein in V. cholerae, VC0395_A0854 might contribute to pathogenesis through several potential mechanisms:

  • Membrane integrity maintenance during host colonization

  • Participation in adhesion to host cells

  • Transport of molecules relevant to virulence

  • Stress response during host immune attack

  • Biofilm formation or regulation

To investigate these possibilities, researchers should consider gene knockout studies followed by phenotypic analysis of virulence traits, host cell interaction assays, and in vivo infection models. Additionally, transcriptomic analysis during infection could reveal expression patterns indicative of specific roles in pathogenesis.

Is there evidence linking VC0395_A0854 to antibiotic resistance mechanisms in V. cholerae?

While the search results do not directly link VC0395_A0854 to antibiotic resistance, V. cholerae strains have been shown to acquire resistance through various mechanisms including conjugative plasmids like pVCR94 . The pVCR94 plasmid confers resistance to multiple antibiotics including sulfamethoxazole, trimethoprim, ampicillin, streptomycin, tetracycline, and chloramphenicol . To investigate potential associations between VC0395_A0854 and resistance mechanisms, researchers could:

  • Analyze expression changes of VC0395_A0854 under antibiotic stress

  • Determine if VC0395_A0854 knockouts alter minimum inhibitory concentrations (MICs)

  • Assess potential interactions with known resistance proteins

  • Investigate structural similarities with characterized antibiotic efflux proteins

The following table shows MIC values for E. coli carrying the pVCR94 plasmid, demonstrating the multi-drug resistance phenotype that could be relevant for comparative studies:

AntibioticResistance Pattern
SulfamethoxazoleResistant
TrimethoprimResistant
AmpicillinResistant
StreptomycinResistant
TetracyclineResistant
ChloramphenicolResistant
GentamycinSusceptible
KanamycinSusceptible
RifampicinSusceptible
Nalidixic acidSusceptible
ErythromycinSusceptible

What are the most informative assays for determining VC0395_A0854 protein interactions?

To characterize protein interactions involving VC0395_A0854, researchers should consider a multi-faceted approach:

  • Bacterial two-hybrid or yeast two-hybrid screening with appropriate modifications for membrane proteins

  • Co-immunoprecipitation followed by mass spectrometry (MS) analysis

  • Crosslinking coupled with MS identification (XL-MS)

  • Surface plasmon resonance (SPR) for quantitative binding kinetics

  • Microscale thermophoresis for detecting interactions in solution

  • Biolayer interferometry for real-time interaction analysis

  • Förster resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET) for in vivo interaction studies

For membrane proteins specifically, researchers should consider incorporating nanodiscs or liposomes to maintain the protein in a membrane-like environment during interaction studies. This approach preserves native conformation and can reveal interactions that depend on the membrane context.

How should researchers design gene knockout studies to investigate VC0395_A0854 function?

Effective gene knockout studies for VC0395_A0854 should include:

  • Creation of clean deletion mutants using allelic exchange techniques

  • Complementation controls to verify phenotype specificity

  • Construction of conditional mutants if the gene is essential

  • Generation of point mutations in key residues to identify functional domains

  • Comparative phenotypic analysis across multiple growth conditions

A comprehensive phenotypic characterization should include growth curves, biofilm formation, motility assays, stress response assessment, and virulence assays in appropriate models. The use of high-throughput phenotypic microarrays (e.g., Biolog) can efficiently screen for conditional phenotypes across hundreds of growth conditions simultaneously.

What approaches can be used to study the membrane topology of VC0395_A0854?

Determining the membrane topology of VC0395_A0854 requires specialized techniques for membrane proteins:

  • Cysteine accessibility methods (SCAM - substituted cysteine accessibility method)

  • Protease protection assays with membrane vesicles

  • Fluorescence quenching techniques

  • Epitope insertion followed by immunolabeling

  • Cryo-electron microscopy of membrane-embedded protein

  • GFP-fusion reporter systems with truncated constructs

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

Researchers should compare experimental results with computational predictions from tools like TMHMM, TOPCONS, or Phobius to build a comprehensive topological model. This information is crucial for understanding protein function and designing targeted mutations for functional studies.

How can structural biology approaches be optimized for VC0395_A0854?

Structural determination of membrane proteins like VC0395_A0854 presents unique challenges requiring specialized approaches:

  • Detergent screening is critical—mild detergents like DDM, LMNG, or GDN often preserve structure

  • Lipidic cubic phase crystallization may improve crystal quality compared to traditional vapor diffusion

  • Nanodiscs or amphipols can stabilize the protein for single-particle cryo-EM analysis

  • Solid-state NMR can provide structural information without crystallization

  • Micro-ED (electron diffraction) can be used with microcrystals unsuitable for X-ray diffraction

For VC0395_A0854 specifically, researchers should consider a parallel approach using both X-ray crystallography and cryo-EM to maximize the chances of structural determination. Additionally, fragment screening by NMR or thermal shift assays can identify stabilizing compounds that might facilitate crystallization.

What is the role of VC0395_A0854 in bacterial stress response and adaptation?

To investigate VC0395_A0854's potential role in stress response:

  • Monitor expression levels under various stresses (pH, osmolarity, bile salts, antimicrobials)

  • Compare survival of wild-type and knockout strains under stress conditions

  • Identify stress-dependent protein interactions using pull-down assays

  • Examine localization changes during stress using fluorescence microscopy

  • Perform transcriptomic and proteomic profiling of knockout strains under stress

Researchers should pay particular attention to conditions mimicking the human intestinal environment, as these are relevant to V. cholerae pathogenesis. Time-course experiments can reveal whether VC0395_A0854 is involved in immediate stress response or long-term adaptation mechanisms.

How does VC0395_A0854 compare between different V. cholerae isolates, particularly in relation to epidemic strains?

Comparative analysis of VC0395_A0854 across V. cholerae isolates can provide evolutionary and functional insights:

  • Sequence analysis across historical and contemporary epidemic isolates

  • Examination of selection pressure signatures in the gene sequence

  • Correlation of sequence variations with virulence or environmental persistence

  • Functional complementation studies across different strain backgrounds

  • Analysis of genomic neighborhood conservation or variability

Researchers could specifically compare isolates from different cholera pandemics or from clinical versus environmental sources. The Rwandan epidemic isolate described in search result could serve as an important reference point for such comparative studies.

How can transcriptomic and proteomic approaches inform VC0395_A0854 function?

Multi-omics approaches can provide comprehensive insights into VC0395_A0854 function:

  • RNA-Seq of knockout strains to identify dysregulated pathways

  • Proteomics to detect altered protein abundance or post-translational modifications

  • Ribosome profiling to assess translational impacts

  • Metabolomics to identify affected metabolic pathways

  • ChIP-Seq if VC0395_A0854 has potential DNA-binding domains

Integration of these datasets using systems biology approaches can reveal functional networks and unexpected connections. Temporal sampling during infection or stress response can capture dynamic changes in these networks. Comparison with existing datasets from other V. cholerae studies can further contextualize findings within the broader knowledge base.

What computational approaches can predict interaction partners for VC0395_A0854?

Computational prediction of protein interactions can guide experimental work:

  • Sequence-based methods (co-evolution analysis, domain-domain interaction prediction)

  • Structure-based approaches (protein-protein docking, electrostatic complementarity analysis)

  • Genomic context methods (gene neighborhood, gene fusion, phylogenetic profiling)

  • Text mining of scientific literature for implicit connections

  • Machine learning approaches trained on known bacterial protein interaction networks

For membrane proteins specifically, tools that account for the membrane environment in predictions are preferable. Integration of multiple prediction methods typically provides more reliable results than any single approach. Predictions should be prioritized for experimental validation based on confidence scores and biological relevance.

How can researchers investigate the potential role of VC0395_A0854 in biofilm formation?

Biofilm formation is critical for V. cholerae environmental persistence and pathogenesis. To investigate VC0395_A0854's potential role:

  • Compare biofilm formation between wild-type and knockout strains using crystal violet assays

  • Analyze biofilm architecture using confocal microscopy and fluorescent strains

  • Examine expression changes during biofilm development using reporter constructs

  • Assess contribution to matrix production through biochemical characterization

  • Investigate protein localization within biofilm structures

  • Determine impact on biofilm dispersal and regrowth

  • Evaluate competitive fitness within mixed-strain biofilms

Researchers should test biofilm formation under multiple conditions including those mimicking aquatic environments and the human gastrointestinal tract, as V. cholerae forms biofilms in both contexts with potentially different requirements.

Could VC0395_A0854 serve as a potential target for anti-Vibrio therapeutics?

To evaluate VC0395_A0854 as a potential therapeutic target:

  • Assess essentiality through gene knockout or CRISPRi studies

  • Determine conservation across pathogenic Vibrio species

  • Evaluate accessibility of the protein to small molecules

  • Screen for inhibitory compounds using in vitro assays

  • Test promising compounds for specificity and toxicity

  • Develop structure-activity relationships for lead optimization

  • Validate in infection models

Researchers should consider combination approaches, as targeting membrane proteins alone may lead to resistance development. The potential for cross-reactivity with human proteins should be carefully assessed through homology comparison and experimental validation in mammalian cell lines.

How might VC0395_A0854 contribute to diagnostic or vaccine development for cholera?

Potential applications in diagnostics or vaccines include:

  • Assessment as a biomarker for specific V. cholerae strains

  • Evaluation of immunogenicity and conservation for vaccine development

  • Determination of surface exposure for antibody accessibility

  • Development of recombinant protein-based detection methods

  • Investigation as a carrier protein for polysaccharide antigens

For diagnostic applications, researchers should evaluate specificity across Vibrio species and related pathogens. For vaccine applications, animal studies would be needed to assess protective immunity and potential adverse effects. The recombinant protein production methods described earlier would be relevant for obtaining material for these translational studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.