Recombinant Vibrio cholerae serotype O1 UPF0299 membrane protein VC_1233 (UniProt ID: Q9KSM3) is a 129-amino-acid transmembrane protein expressed in Escherichia coli with an N-terminal polyhistidine (His) tag for purification . Its sequence (MLILLMIKKIAQYCVSMGLIFLCLLAGINLQTWLGIAIPGSIIGLLILFGLMASGLVPVE WVKPSATLFIRYMILLFVPISVGLMVHFDTLLANLAPILASAIGGTLIVMVTLGLILDRM LKKGKKSCG) suggests a hydrophobic structure typical of membrane-embedded proteins .
Recombinant VC_1233 is produced via plasmid-based expression in E. coli, followed by nickel-affinity chromatography . Critical parameters include:
While VC_1233’s exact biological function remains uncharacterized, genomic studies associate it with the SXT integrative conjugative element (ICE), which confers antibiotic resistance and virulence in pandemic V. cholerae O1 . Key findings:
Co-occurs with CTXΦ prophage and Vibrio Pathogenicity Island-1 (VPI-1) in toxigenic strains .
Structural modeling suggests interactions with lipid bilayers via hydrophobic residues (e.g., Leu15, Ile22, Phe67) .
Antigen Development: Used in ELISA kits for cholera serodiagnosis due to its immunogenic epitopes .
Membrane Protein Studies:
Drug Target Screening: Potential candidate for inhibitors targeting V. cholerae membrane integrity .
While E. coli remains the primary host for VC_1233 production, alternative systems include:
Functional Annotation: Mechanistic studies are needed to clarify VC_1233’s role in virulence or environmental adaptation.
Structural Resolution: X-ray crystallography or cryo-EM could map its 3D conformation .
Biotechnological Optimization: Codon optimization or fusion tags may enhance solubility and yield .
KEGG: vch:VC1233
STRING: 243277.VC1233
VC_1233 is a membrane-associated protein belonging to the UPF0299 family found in Vibrio cholerae serotype O1. Although complete structural characterization remains limited, it features transmembrane domains that anchor it within the bacterial cell envelope. The protein likely contains hydrophobic regions consistent with membrane proteins that participate in V. cholerae's cellular functions.
For structural analysis, researchers typically employ:
X-ray crystallography (challenging with membrane proteins)
Nuclear magnetic resonance (NMR) spectroscopy
Cryo-electron microscopy
Computational structure prediction methods
When conducting structural studies, detergent solubilization is necessary to maintain protein integrity outside the lipid bilayer environment. Comparative analysis with other UPF0299 family proteins can provide initial structural insights while awaiting definitive experimental data.
Membrane integrity maintenance
Environmental sensing mechanisms
Transport processes
Stress response pathways
V. cholerae pathogenesis relies on multiple factors beyond CT and TCP, including colonization factors, motility mechanisms, and environmental adaptation capabilities. Membrane proteins often participate in sensing environmental cues that trigger virulence gene expression or aid in adaptation to host conditions.
For definitive functional characterization, recommended approaches include:
Gene knockout studies with virulence phenotype assessment
Complementation assays
Protein-protein interaction studies with known virulence factors
Expressing membrane proteins presents significant challenges due to their hydrophobic nature and complex folding requirements. For VC_1233, several expression systems warrant consideration:
| Expression System | Advantages | Limitations | Optimization Strategies |
|---|---|---|---|
| E. coli BL21(DE3) derivatives | Cost-effective, high yield | Inclusion body formation common | Lower temperature (16-20°C), reduced inducer concentration |
| C41/C43 E. coli strains | Designed for toxic membrane proteins | Lower expression yield | Extended induction time (24-48h) |
| Cell-free systems | Bypasses toxicity issues | Expensive, lower yield | Addition of lipid nanodiscs or detergent micelles |
| Yeast expression (P. pastoris) | Post-translational modifications | Longer development time | Codon optimization, signal sequence refinement |
When expressing recombinant V. cholerae proteins, inclusion of solubility-enhancing tags (MBP, SUMO) can improve folding, while purification tags (His6, Strep-tag) facilitate downstream processing . The expression system should be selected based on the intended application, with cell-free systems often preferred for structural biology and E. coli-based systems for functional studies.
Determining membrane protein topology requires multiple complementary approaches to generate a reliable model. For VC_1233, a systematic approach would include:
Computational prediction:
TMHMM, MEMSAT, and PredictProtein provide initial topology models
Analysis of evolutionary conservation patterns in transmembrane segments
Hydrophobicity plots to identify potential membrane-spanning regions
Experimental validation:
Cysteine accessibility methods: Introduction of cysteine residues followed by labeling with membrane-impermeable reagents
Reporter fusion analysis: Creating fusions with GFP, PhoA, or LacZ at various positions
Protease protection assays: Limited proteolysis followed by mass spectrometry identification
Structural methods:
Hydrogen-deuterium exchange mass spectrometry to identify solvent-accessible regions
Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling
To resolve discrepancies between methods, researchers should conduct iterative experimentation and consider potential artifacts introduced by the experimental system, such as altered membrane composition in heterologous hosts or conformational changes induced by fusion tags.
V. cholerae exhibits distinctive "run-reverse-flick" motility patterns facilitated by its single polar flagellum . This complex movement pattern involves:
Forward runs (pushing by counterclockwise flagellar rotation)
Reversals (clockwise rotation causing directional change)
Flick motions (reorientation events)
While the specific contribution of VC_1233 to motility has not been definitively established, membrane proteins often influence bacterial movement through:
Signal transduction: Transmitting environmental cues to the flagellar apparatus
Energy provision: Maintaining proton motive force necessary for flagellar rotation
Protein-protein interactions: Potentially interacting with basal body components
To investigate VC_1233's potential role in motility, researchers should employ:
3D bacterial tracking techniques to analyze swimming patterns in VC_1233 mutants
Fluorescent localization studies during different motility phases
Comparative motility assays under varying environmental conditions
The average swimming speed of wild-type V. cholerae in standard motility buffer is approximately 94 μm/s, with forward runs showing right-handed trajectory curvature when swimming along surfaces . These parameters provide baseline measurements for assessing motility phenotypes in VC_1233 mutants.
Understanding interaction partners provides crucial insights into functional roles. For membrane proteins like VC_1233, several complementary techniques are recommended:
In vivo approaches:
Bacterial two-hybrid systems adapted for membrane proteins (BACTH)
Proximity labeling using BioID or APEX2 fusions
In vivo crosslinking followed by co-immunoprecipitation
In vitro methods:
Pull-down assays with purified components
Surface plasmon resonance (SPR) or bio-layer interferometry
Isothermal titration calorimetry (ITC) for thermodynamic parameters
Structural approaches:
Crosslinking mass spectrometry (XL-MS) to capture transient interactions
Hydrogen-deuterium exchange mass spectrometry to identify binding interfaces
Cryo-EM of protein complexes
When designing interaction studies, researchers should consider:
The dynamic nature of membrane protein interactions
Potential artifacts introduced by overexpression
The impact of detergents on interaction stability during purification
The need for appropriate negative controls
Validation through multiple independent methods is essential for generating reliable interaction networks. For V. cholerae membrane proteins, considering potential interactions with virulence-associated systems is particularly important.
Purifying membrane proteins while maintaining functional integrity requires careful optimization. Based on established protocols for similar proteins, a recommended workflow includes:
Membrane fraction isolation:
Differential centrifugation following cell lysis
Separation of membrane fractions from cytoplasmic components
Washing steps to remove peripheral proteins
Solubilization optimization:
| Detergent | Typical Concentration | Extraction Efficiency | Protein Stability | Functional Retention |
|---|---|---|---|---|
| DDM | 0.5-1.0% | High (70-90%) | Good (days) | Moderate (50-70%) |
| LMNG | 0.05-0.1% | Moderate (40-60%) | Excellent (weeks) | High (70-90%) |
| Digitonin | 0.5-1.0% | Low (20-40%) | Very good (weeks) | Very high (80-95%) |
| LDAO | 0.5-1.0% | High (80-95%) | Poor (hours) | Low (30-50%) |
Chromatographic purification:
Immobilized metal affinity chromatography (IMAC) utilizing His-tags
Size exclusion chromatography for oligomeric state assessment
Ion exchange chromatography for further purification
Quality assessment:
SDS-PAGE and Western blotting for purity evaluation
Mass spectrometry for identity confirmation
Thermal shift assays for stability assessment
Circular dichroism for secondary structure analysis
For functional studies, reconstitution into proteoliposomes or nanodiscs following purification may be necessary to provide a lipid environment that supports native activity.
Site-directed mutagenesis provides a powerful approach for structure-function analysis. When designing a mutagenesis strategy for VC_1233, researchers should:
Select targets based on:
Sequence conservation across bacterial homologs
Predicted functional domains
Computational analysis identifying potentially important residues
Preliminary structural data
Design appropriate mutations:
Conservative substitutions to test specific chemical properties
Alanine scanning to remove side chain interactions
Introduction of charged residues to disrupt hydrophobic interactions
Cysteine substitutions for subsequent modification studies
Implement efficient technical approaches:
QuikChange-type PCR for simple substitutions
Gibson Assembly for complex modifications
CRISPR/Cas9-based approaches for chromosomal modifications
Develop systematic validation procedures:
| Mutation Type | Purpose | Validation Approach | Expected Outcome |
|---|---|---|---|
| Transmembrane residues | Test membrane insertion | Membrane fractionation | Altered localization |
| Conserved motifs | Identify essential regions | Complementation studies | Functional defects |
| Surface-exposed residues | Test interaction interfaces | Binding assays | Altered protein interactions |
| Charged residues | Probe electrostatic interactions | Activity assays | Modified functional properties |
When interpreting mutagenesis results, researchers should consider potential long-range structural effects that may complicate the assignment of direct functional roles to specific residues.
Membrane proteins frequently contribute to antibiotic resistance through various mechanisms. To investigate VC_1233's potential role:
Expression analysis:
Genetic manipulation studies:
Create gene knockout and overexpression strains
Determine minimum inhibitory concentrations (MICs) for various antibiotics
Conduct time-kill kinetics with antibiotics targeting membrane integrity
Mechanistic investigations:
Measure membrane permeability in wildtype vs. mutant strains
Assess potential interactions with known resistance determinants
Evaluate efflux pump activity
Recent studies have demonstrated increasing multidrug resistance in V. cholerae isolates, particularly against first- and second-line antibiotics . If VC_1233 contributes to this resistance, it could represent a potential target for adjuvant therapies designed to enhance antibiotic efficacy.
The development of effective cholera vaccines remains an important public health goal. Evaluating VC_1233's potential as a vaccine component requires assessment of several key factors:
Immunogenicity determinants:
Surface exposure and accessibility to antibodies
Conservation across clinically relevant V. cholerae strains
Presence of immunodominant epitopes
Ability to elicit protective immune responses
Technical considerations:
Feasibility of large-scale production with proper folding
Stability in vaccine formulations
Compatibility with adjuvants
Delivery system requirements for mucosal immunity
Comparative assessment:
Previous work with recombinant V. cholerae strains demonstrates the feasibility of creating live attenuated vaccine candidates through genetic modification . If pursued as a vaccine component, VC_1233 would need to be evaluated in both Ogawa and Inaba serotypes to ensure comprehensive protection.
Designing robust immunogenicity studies requires careful consideration of multiple factors:
Antigen preparation strategies:
Recombinant full-length protein in detergent micelles
Extracellular domain constructs (if applicable)
Peptide epitopes from conserved regions
Incorporation into virus-like particles or outer membrane vesicles
Immunization protocols:
Route of administration (mucosal vs. parenteral)
Prime-boost strategies
Adjuvant selection for membrane proteins
Dosing schedule optimization
Immune response evaluation:
Antibody titer measurement (IgG, IgA)
Functional assays (bacterial growth inhibition, neutralization)
T-cell response characterization
Memory B-cell analysis
Challenge models:
Infant mouse colonization model
Adult rabbit ileal loop model
Controlled human infection models (if appropriate regulatory approval)
When assessing protective efficacy, researchers should consider both serotype-specific and cross-protective responses. Current WHO-licensed cholera vaccines include both Ogawa and Inaba serotypes to provide comprehensive protection , and any VC_1233-based approach would need similar considerations.
Research on membrane proteins like VC_1233 presents several technical challenges:
Expression and purification issues:
Problem: Inclusion body formation
Solution: Lower induction temperature (16°C), use solubility-enhancing fusion tags
Problem: Low yield from membrane fraction
Solution: Optimize detergent selection, consider specialized extraction buffers
Problem: Protein instability after purification
Solution: Add stabilizing agents (glycerol, specific lipids), minimize freeze-thaw cycles
Functional characterization challenges:
Problem: Lack of known functional assays
Solution: Develop phenotypic assays in knockout strains, identify interaction partners
Problem: Loss of activity during purification
Solution: Reconstitute in lipid nanodiscs or proteoliposomes to restore native environment
Problem: Conflicting results between in vitro and in vivo studies
Solution: Validate with multiple complementary approaches, consider physiological context
Structural analysis difficulties:
Problem: Inability to obtain diffracting crystals
Solution: Screen multiple constructs, detergents, and crystallization conditions
Problem: Sample heterogeneity in structural studies
Solution: Employ size exclusion chromatography with multi-angle light scattering (SEC-MALS)
Problem: Aggregation during concentration
Solution: Use amphipols or other stabilizing agents, optimize buffer conditions
When troubleshooting these issues, researchers should document all experimental conditions systematically and implement iterative optimization approaches.