Recombinant Vibrio cholerae serotype O1 UPF0299 membrane protein VC_1233 (VC_1233)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Vibrio cholerae serotype O1 UPF0299 membrane protein VC_1233 (UniProt ID: Q9KSM3) is a 129-amino-acid transmembrane protein expressed in Escherichia coli with an N-terminal polyhistidine (His) tag for purification . Its sequence (MLILLMIKKIAQYCVSMGLIFLCLLAGINLQTWLGIAIPGSIIGLLILFGLMASGLVPVE WVKPSATLFIRYMILLFVPISVGLMVHFDTLLANLAPILASAIGGTLIVMVTLGLILDRM LKKGKKSCG) suggests a hydrophobic structure typical of membrane-embedded proteins .

PropertySpecification
Host OrganismVibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Expression SystemE. coli
TagHis-Tag
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) at -20°C/-80°C
Reconstitution0.1–1.0 mg/mL in sterile water, with 5–50% glycerol for long-term stability

Production and Purification

Recombinant VC_1233 is produced via plasmid-based expression in E. coli, followed by nickel-affinity chromatography . Critical parameters include:

ParameterDetail
VectorpET-based plasmid with T7 promoter
InductionIPTG-induced expression
Yield~1–2 mg/L culture (lyophilized form)
StabilityDegrades after >3 freeze-thaw cycles; stable for 12 months at -80°C

Functional and Pathogenic Role

While VC_1233’s exact biological function remains uncharacterized, genomic studies associate it with the SXT integrative conjugative element (ICE), which confers antibiotic resistance and virulence in pandemic V. cholerae O1 . Key findings:

  • Co-occurs with CTXΦ prophage and Vibrio Pathogenicity Island-1 (VPI-1) in toxigenic strains .

  • Structural modeling suggests interactions with lipid bilayers via hydrophobic residues (e.g., Leu15, Ile22, Phe67) .

Applications in Research

  1. Antigen Development: Used in ELISA kits for cholera serodiagnosis due to its immunogenic epitopes .

  2. Membrane Protein Studies:

    • Serves as a model for cotranslational folding analysis using force-profile (FP) and molecular dynamics (MD) simulations .

    • Validates MCP predictors for transmembrane helix orientation .

  3. Drug Target Screening: Potential candidate for inhibitors targeting V. cholerae membrane integrity .

Comparative Analysis of Expression Systems

While E. coli remains the primary host for VC_1233 production, alternative systems include:

SystemAdvantageLimitation
E. coliHigh yield, low costLimited post-translational modifications
Pichia pastorisEukaryotic glycosylationLower scalability vs. bacterial systems
Mammalian (CHO/HEK293)Human-like modificationsHigh cost, technical complexity

Challenges and Future Directions

  • Functional Annotation: Mechanistic studies are needed to clarify VC_1233’s role in virulence or environmental adaptation.

  • Structural Resolution: X-ray crystallography or cryo-EM could map its 3D conformation .

  • Biotechnological Optimization: Codon optimization or fusion tags may enhance solubility and yield .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during the production process. If you have a preferred tag type, please inform us and we will prioritize developing it.
Synonyms
VC_1233; UPF0299 membrane protein VC_1233
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Target Names
VC_1233
Target Protein Sequence
MLILLMIKKIAQYCVSMGLIFLCLLAGINLQTWLGIAIPGSIIGLLILFGLMASGLVPVE WVKPSATLFIRYMILLFVPISVGLMVHFDTLLANLAPILASAIGGTLIVMVTLGLILDRM LKKGKKSCG
Uniprot No.

Target Background

Database Links

KEGG: vch:VC1233

STRING: 243277.VC1233

Protein Families
UPF0299 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of VC_1233 membrane protein?

VC_1233 is a membrane-associated protein belonging to the UPF0299 family found in Vibrio cholerae serotype O1. Although complete structural characterization remains limited, it features transmembrane domains that anchor it within the bacterial cell envelope. The protein likely contains hydrophobic regions consistent with membrane proteins that participate in V. cholerae's cellular functions.

For structural analysis, researchers typically employ:

  • X-ray crystallography (challenging with membrane proteins)

  • Nuclear magnetic resonance (NMR) spectroscopy

  • Cryo-electron microscopy

  • Computational structure prediction methods

When conducting structural studies, detergent solubilization is necessary to maintain protein integrity outside the lipid bilayer environment. Comparative analysis with other UPF0299 family proteins can provide initial structural insights while awaiting definitive experimental data.

How does VC_1233 relate to Vibrio cholerae pathogenesis?

  • Membrane integrity maintenance

  • Environmental sensing mechanisms

  • Transport processes

  • Stress response pathways

V. cholerae pathogenesis relies on multiple factors beyond CT and TCP, including colonization factors, motility mechanisms, and environmental adaptation capabilities. Membrane proteins often participate in sensing environmental cues that trigger virulence gene expression or aid in adaptation to host conditions.

For definitive functional characterization, recommended approaches include:

  • Gene knockout studies with virulence phenotype assessment

  • Complementation assays

  • Protein-protein interaction studies with known virulence factors

What expression systems are optimal for producing recombinant VC_1233?

Expressing membrane proteins presents significant challenges due to their hydrophobic nature and complex folding requirements. For VC_1233, several expression systems warrant consideration:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coli BL21(DE3) derivativesCost-effective, high yieldInclusion body formation commonLower temperature (16-20°C), reduced inducer concentration
C41/C43 E. coli strainsDesigned for toxic membrane proteinsLower expression yieldExtended induction time (24-48h)
Cell-free systemsBypasses toxicity issuesExpensive, lower yieldAddition of lipid nanodiscs or detergent micelles
Yeast expression (P. pastoris)Post-translational modificationsLonger development timeCodon optimization, signal sequence refinement

When expressing recombinant V. cholerae proteins, inclusion of solubility-enhancing tags (MBP, SUMO) can improve folding, while purification tags (His6, Strep-tag) facilitate downstream processing . The expression system should be selected based on the intended application, with cell-free systems often preferred for structural biology and E. coli-based systems for functional studies.

How can researchers accurately determine the membrane topology of VC_1233?

Determining membrane protein topology requires multiple complementary approaches to generate a reliable model. For VC_1233, a systematic approach would include:

  • Computational prediction:

    • TMHMM, MEMSAT, and PredictProtein provide initial topology models

    • Analysis of evolutionary conservation patterns in transmembrane segments

    • Hydrophobicity plots to identify potential membrane-spanning regions

  • Experimental validation:

    • Cysteine accessibility methods: Introduction of cysteine residues followed by labeling with membrane-impermeable reagents

    • Reporter fusion analysis: Creating fusions with GFP, PhoA, or LacZ at various positions

    • Protease protection assays: Limited proteolysis followed by mass spectrometry identification

  • Structural methods:

    • Hydrogen-deuterium exchange mass spectrometry to identify solvent-accessible regions

    • Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling

To resolve discrepancies between methods, researchers should conduct iterative experimentation and consider potential artifacts introduced by the experimental system, such as altered membrane composition in heterologous hosts or conformational changes induced by fusion tags.

What role might VC_1233 play in Vibrio cholerae motility and colonization?

V. cholerae exhibits distinctive "run-reverse-flick" motility patterns facilitated by its single polar flagellum . This complex movement pattern involves:

  • Forward runs (pushing by counterclockwise flagellar rotation)

  • Reversals (clockwise rotation causing directional change)

  • Flick motions (reorientation events)

While the specific contribution of VC_1233 to motility has not been definitively established, membrane proteins often influence bacterial movement through:

  • Signal transduction: Transmitting environmental cues to the flagellar apparatus

  • Energy provision: Maintaining proton motive force necessary for flagellar rotation

  • Protein-protein interactions: Potentially interacting with basal body components

To investigate VC_1233's potential role in motility, researchers should employ:

  • 3D bacterial tracking techniques to analyze swimming patterns in VC_1233 mutants

  • Fluorescent localization studies during different motility phases

  • Comparative motility assays under varying environmental conditions

The average swimming speed of wild-type V. cholerae in standard motility buffer is approximately 94 μm/s, with forward runs showing right-handed trajectory curvature when swimming along surfaces . These parameters provide baseline measurements for assessing motility phenotypes in VC_1233 mutants.

What methodologies are most effective for studying VC_1233 protein-protein interactions?

Understanding interaction partners provides crucial insights into functional roles. For membrane proteins like VC_1233, several complementary techniques are recommended:

  • In vivo approaches:

    • Bacterial two-hybrid systems adapted for membrane proteins (BACTH)

    • Proximity labeling using BioID or APEX2 fusions

    • In vivo crosslinking followed by co-immunoprecipitation

  • In vitro methods:

    • Pull-down assays with purified components

    • Surface plasmon resonance (SPR) or bio-layer interferometry

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Structural approaches:

    • Crosslinking mass spectrometry (XL-MS) to capture transient interactions

    • Hydrogen-deuterium exchange mass spectrometry to identify binding interfaces

    • Cryo-EM of protein complexes

When designing interaction studies, researchers should consider:

  • The dynamic nature of membrane protein interactions

  • Potential artifacts introduced by overexpression

  • The impact of detergents on interaction stability during purification

  • The need for appropriate negative controls

Validation through multiple independent methods is essential for generating reliable interaction networks. For V. cholerae membrane proteins, considering potential interactions with virulence-associated systems is particularly important.

What purification strategies yield highest functional recovery of recombinant VC_1233?

Purifying membrane proteins while maintaining functional integrity requires careful optimization. Based on established protocols for similar proteins, a recommended workflow includes:

  • Membrane fraction isolation:

    • Differential centrifugation following cell lysis

    • Separation of membrane fractions from cytoplasmic components

    • Washing steps to remove peripheral proteins

  • Solubilization optimization:

DetergentTypical ConcentrationExtraction EfficiencyProtein StabilityFunctional Retention
DDM0.5-1.0%High (70-90%)Good (days)Moderate (50-70%)
LMNG0.05-0.1%Moderate (40-60%)Excellent (weeks)High (70-90%)
Digitonin0.5-1.0%Low (20-40%)Very good (weeks)Very high (80-95%)
LDAO0.5-1.0%High (80-95%)Poor (hours)Low (30-50%)
  • Chromatographic purification:

    • Immobilized metal affinity chromatography (IMAC) utilizing His-tags

    • Size exclusion chromatography for oligomeric state assessment

    • Ion exchange chromatography for further purification

  • Quality assessment:

    • SDS-PAGE and Western blotting for purity evaluation

    • Mass spectrometry for identity confirmation

    • Thermal shift assays for stability assessment

    • Circular dichroism for secondary structure analysis

For functional studies, reconstitution into proteoliposomes or nanodiscs following purification may be necessary to provide a lipid environment that supports native activity.

What are the most effective approaches for generating site-directed mutants of VC_1233?

Site-directed mutagenesis provides a powerful approach for structure-function analysis. When designing a mutagenesis strategy for VC_1233, researchers should:

  • Select targets based on:

    • Sequence conservation across bacterial homologs

    • Predicted functional domains

    • Computational analysis identifying potentially important residues

    • Preliminary structural data

  • Design appropriate mutations:

    • Conservative substitutions to test specific chemical properties

    • Alanine scanning to remove side chain interactions

    • Introduction of charged residues to disrupt hydrophobic interactions

    • Cysteine substitutions for subsequent modification studies

  • Implement efficient technical approaches:

    • QuikChange-type PCR for simple substitutions

    • Gibson Assembly for complex modifications

    • CRISPR/Cas9-based approaches for chromosomal modifications

  • Develop systematic validation procedures:

Mutation TypePurposeValidation ApproachExpected Outcome
Transmembrane residuesTest membrane insertionMembrane fractionationAltered localization
Conserved motifsIdentify essential regionsComplementation studiesFunctional defects
Surface-exposed residuesTest interaction interfacesBinding assaysAltered protein interactions
Charged residuesProbe electrostatic interactionsActivity assaysModified functional properties

When interpreting mutagenesis results, researchers should consider potential long-range structural effects that may complicate the assignment of direct functional roles to specific residues.

How can researchers assess the contribution of VC_1233 to antibiotic resistance mechanisms?

Membrane proteins frequently contribute to antibiotic resistance through various mechanisms. To investigate VC_1233's potential role:

  • Expression analysis:

    • Compare expression levels between resistant and susceptible strains

    • Analyze transcriptomic/proteomic data under antibiotic stress conditions

    • Examine expression in clinical isolates with varying resistance profiles

  • Genetic manipulation studies:

    • Create gene knockout and overexpression strains

    • Determine minimum inhibitory concentrations (MICs) for various antibiotics

    • Conduct time-kill kinetics with antibiotics targeting membrane integrity

  • Mechanistic investigations:

    • Measure membrane permeability in wildtype vs. mutant strains

    • Assess potential interactions with known resistance determinants

    • Evaluate efflux pump activity

Recent studies have demonstrated increasing multidrug resistance in V. cholerae isolates, particularly against first- and second-line antibiotics . If VC_1233 contributes to this resistance, it could represent a potential target for adjuvant therapies designed to enhance antibiotic efficacy.

What factors determine the suitability of VC_1233 as a potential vaccine antigen?

The development of effective cholera vaccines remains an important public health goal. Evaluating VC_1233's potential as a vaccine component requires assessment of several key factors:

  • Immunogenicity determinants:

    • Surface exposure and accessibility to antibodies

    • Conservation across clinically relevant V. cholerae strains

    • Presence of immunodominant epitopes

    • Ability to elicit protective immune responses

  • Technical considerations:

    • Feasibility of large-scale production with proper folding

    • Stability in vaccine formulations

    • Compatibility with adjuvants

    • Delivery system requirements for mucosal immunity

  • Comparative assessment:

Antigen TypeAdvantagesLimitationsDevelopment Considerations
Membrane proteins (e.g., VC_1233)Surface-exposed, potential functional neutralizationChallenging production, conformational epitopesRequires specialized expression systems
Toxin derivativesWell-established immunogenicityMay not prevent colonizationSafe detoxification necessary
O-antigen componentsSerogroup-specific protectionLimited cross-protectionMust include both Ogawa and Inaba serotypes
Colonization factorsMay prevent initial infectionVariable expression in strainsConsider combining with other antigens

Previous work with recombinant V. cholerae strains demonstrates the feasibility of creating live attenuated vaccine candidates through genetic modification . If pursued as a vaccine component, VC_1233 would need to be evaluated in both Ogawa and Inaba serotypes to ensure comprehensive protection.

How should researchers design immunogenicity studies for VC_1233-based vaccine candidates?

Designing robust immunogenicity studies requires careful consideration of multiple factors:

  • Antigen preparation strategies:

    • Recombinant full-length protein in detergent micelles

    • Extracellular domain constructs (if applicable)

    • Peptide epitopes from conserved regions

    • Incorporation into virus-like particles or outer membrane vesicles

  • Immunization protocols:

    • Route of administration (mucosal vs. parenteral)

    • Prime-boost strategies

    • Adjuvant selection for membrane proteins

    • Dosing schedule optimization

  • Immune response evaluation:

    • Antibody titer measurement (IgG, IgA)

    • Functional assays (bacterial growth inhibition, neutralization)

    • T-cell response characterization

    • Memory B-cell analysis

  • Challenge models:

    • Infant mouse colonization model

    • Adult rabbit ileal loop model

    • Controlled human infection models (if appropriate regulatory approval)

When assessing protective efficacy, researchers should consider both serotype-specific and cross-protective responses. Current WHO-licensed cholera vaccines include both Ogawa and Inaba serotypes to provide comprehensive protection , and any VC_1233-based approach would need similar considerations.

What are common pitfalls in VC_1233 research and how can they be addressed?

Research on membrane proteins like VC_1233 presents several technical challenges:

  • Expression and purification issues:

    • Problem: Inclusion body formation

    • Solution: Lower induction temperature (16°C), use solubility-enhancing fusion tags

    • Problem: Low yield from membrane fraction

    • Solution: Optimize detergent selection, consider specialized extraction buffers

    • Problem: Protein instability after purification

    • Solution: Add stabilizing agents (glycerol, specific lipids), minimize freeze-thaw cycles

  • Functional characterization challenges:

    • Problem: Lack of known functional assays

    • Solution: Develop phenotypic assays in knockout strains, identify interaction partners

    • Problem: Loss of activity during purification

    • Solution: Reconstitute in lipid nanodiscs or proteoliposomes to restore native environment

    • Problem: Conflicting results between in vitro and in vivo studies

    • Solution: Validate with multiple complementary approaches, consider physiological context

  • Structural analysis difficulties:

    • Problem: Inability to obtain diffracting crystals

    • Solution: Screen multiple constructs, detergents, and crystallization conditions

    • Problem: Sample heterogeneity in structural studies

    • Solution: Employ size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Problem: Aggregation during concentration

    • Solution: Use amphipols or other stabilizing agents, optimize buffer conditions

When troubleshooting these issues, researchers should document all experimental conditions systematically and implement iterative optimization approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.