Recombinant Vibrio cholerae serotype O1 UPF0299 membrane protein VCM66_1188 (VCM66_1188)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is produced via recombinant DNA technology in E. coli systems, followed by affinity chromatography using the His tag . Key steps include:

  • Expression: Optimized in E. coli under controlled conditions.

  • Purification: Immobilized metal-ion affinity chromatography (IMAC).

  • Formulation: Lyophilized powder in Tris/PBS-based buffer with 6% trehalose (pH 8.0) .

Reconstitution Protocol:

  1. Centrifuge lyophilized protein briefly before opening.

  2. Resuspend in sterile deionized water to 0.1–1.0 mg/mL.

  3. Add 5–50% glycerol for long-term storage at -20°C/-80°C .

Functional Insights

While functional data specific to VCM66_1188 remains limited, membrane proteins in Vibrio cholerae are often implicated in:

  • Pathogenicity: Interactions with host cells or virulence factors.

  • Antibiotic Resistance: Efflux pumps or membrane transporters .

Limitations:

  • No experimentally confirmed pathways or binding partners are reported for VCM66_1188 in current literature .

  • Studies on homologous proteins suggest roles in solute transport or stress response .

Research Applications

VCM66_1188 is primarily used as a reagent in:

  1. Antibody Development: For detecting Vibrio cholerae antigens .

  2. Structural Studies: Analyzing membrane protein topology via X-ray crystallography or cryo-EM.

  3. Interaction Assays: Screening for ligand binding using methods like SEC-MS (size-exclusion chromatography coupled with mass spectrometry), as demonstrated for other membrane proteins .

Current Research Gaps and Future Directions

  • Functional Characterization: Elucidating its role in Vibrio cholerae physiology or infection.

  • Therapeutic Targeting: Assessing its potential as a vaccine candidate or drug target.

  • Interaction Mapping: Applying SEC-MS or yeast two-hybrid systems to identify binding partners .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
VCM66_1188; UPF0299 membrane protein VCM66_1188
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain M66-2)
Target Names
VCM66_1188
Target Protein Sequence
MLILLMIKKIAQYCVSMGLIFLCLLAGINLQTWLGIAIPGSIIGLLILFGLMASGLVPVE WVKPSATLFIRYMILLFVPISVGLMVHFDTLLANLAPILASAIGGTLIVMVTLGLILDRM LKKGKKSCG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0299 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is VCM66_1188 and what is its biological context?

VCM66_1188 is a UPF0299 membrane protein found in Vibrio cholerae serotype O1 (strain M66-2). This protein belongs to the UPF0299 family of membrane proteins, with its natural length spanning amino acids 1-129. Vibrio cholerae, the source organism, is a Gram-negative, comma-shaped bacterium that naturally inhabits brackish or saltwater environments and is the causative agent of cholera. The bacterium possesses a flagellum at one cell pole as well as pili, and can function as a facultative anaerobe capable of both respiratory and fermentative metabolism .

The genomic context of VCM66_1188 is particularly notable, as it is found within a strain that contains genomic islands of pathogenicity and is lysogenized with phage DNA, meaning viral genes have been integrated into the bacterial genome, contributing to pathogenicity. While the specific function of VCM66_1188 is not fully characterized in the available literature, its membrane localization suggests potential roles in cellular processes such as signaling, transport, or structural integrity.

What expression systems are available for recombinant production of VCM66_1188?

Multiple expression systems can be utilized for the recombinant production of VCM66_1188, each with distinct advantages for different research applications. The protein can be expressed in Escherichia coli, yeast, baculovirus, or mammalian cell systems . Selection of an appropriate expression system should be based on experimental objectives and downstream applications.

Expression SystemAdvantagesLimitationsBest Applications
E. coliHigh yield, rapid growth, cost-effective, easier purificationLimited post-translational modifications, potential issues with membrane protein foldingStructural studies, antibody production
YeastEukaryotic post-translational modifications, good for membrane proteinsLonger cultivation time, more complex mediaFunctional studies requiring glycosylation
BaculovirusAdvanced eukaryotic processing, high-level expressionTechnical complexity, higher costComplex structural studies, enzyme activity analysis
Mammalian CellNative-like folding and modificationsHighest cost, lowest yield, technical expertise requiredInteraction studies, therapeutic applications

For initial characterization studies, E. coli systems often provide sufficient yield for basic structural analysis, while more sophisticated functional studies might benefit from expression in eukaryotic systems to ensure proper folding and post-translational modifications.

What purification strategies are most effective for recombinant VCM66_1188?

Purification of recombinant VCM66_1188 requires careful consideration of its membrane protein nature. Based on available product information, His-tagged versions of the protein are commercially available, suggesting affinity chromatography as an effective initial purification step .

A systematic purification protocol might include:

  • Cell lysis optimization: Membrane proteins require detergent-based extraction. Test multiple detergents (DDM, LDAO, OG) at varying concentrations to identify optimal solubilization conditions.

  • Affinity chromatography: Utilize His-tag affinity as a primary capture step, with imidazole gradient elution to reduce non-specific binding.

  • Size exclusion chromatography: Remove aggregates and further purify monomeric protein.

  • Ion exchange chromatography: As a polishing step to achieve highest purity.

For experimental design, researchers should consider an A₁B₁A₂B₂ reversal design to compare different purification methods, where Phase A represents standard purification conditions and Phase B represents modified conditions . This approach allows for systematic evaluation of purification variables while controlling for batch-to-batch variation.

How can VCM66_1188 be utilized in vaccine development research?

VCM66_1188 presents potential applications in vaccine development research against Vibrio cholerae. As a membrane protein, it may serve as an antigen candidate or as a component in subunit vaccine formulations . The methodological approach to exploring this potential should follow a systematic framework:

  • Immunogenicity assessment: Determine antibody production against recombinant VCM66_1188 in animal models, measuring both quantity and quality of immune responses.

  • Epitope mapping: Identify specific regions of the protein that elicit protective immune responses.

  • Protection studies: Evaluate whether antibodies against VCM66_1188 confer protection in appropriate challenge models.

  • Formulation optimization: Test different adjuvants and delivery systems to enhance immune responses.

For experimental design in vaccine studies, multiple baseline designs across subjects can be particularly valuable, allowing each subject to serve as their own control and accounting for individual immune response variations . This approach is especially important given the variability in immune responses across individuals and can help establish causal relationships between vaccination and protection.

The recombinant version of VCM66_1188 available from commercial sources appears specifically designed for research applications in vaccine development, highlighting its potential significance in this field .

What methodological approaches can elucidate VCM66_1188's role in Vibrio cholerae pathogenesis?

Understanding VCM66_1188's potential role in pathogenesis requires integrated molecular and cellular approaches. Since Vibrio cholerae pathogenicity involves specific virulence factors like cholera toxin and the toxin co-regulated pilus (TCP) , exploring potential interactions between VCM66_1188 and these known virulence systems is essential.

A comprehensive methodological framework might include:

  • Gene knockout/knockdown studies: Create VCM66_1188 deletion mutants and assess changes in virulence phenotypes.

  • Complementation analysis: Restore the wild-type phenotype by reintroducing the functional gene to confirm specificity.

  • Transcriptomic profiling: Compare gene expression patterns between wild-type and mutant strains under various conditions.

  • Infection models: Utilize appropriate in vitro and in vivo models to assess the impact of VCM66_1188 modification on colonization and disease progression.

For these studies, quasi-experimental designs may be necessary, particularly when randomized controlled trials are not feasible due to ethical or practical limitations . Such designs fall between controlled experiments and purely observational studies, allowing researchers to investigate cause-and-effect relationships in real-world settings while maximizing internal validity within practical constraints .

How should contradictory results regarding VCM66_1188 function be analyzed?

When faced with contradictory results regarding VCM66_1188 function, researchers should implement a systematic analytical approach. This situation commonly occurs when studying proteins of unknown function, and resolution requires rigorous methodology rather than dismissing conflicting data.

The recommended analytical framework includes:

  • Methodological assessment: Carefully evaluate experimental conditions across studies, including expression systems, purification methods, and assay conditions. Minor variations can significantly impact membrane protein behavior.

  • Statistical reanalysis: Apply appropriate statistical tests to determine if differences are statistically significant or within expected experimental variation.

  • Independent verification: Design experiments that can specifically address the contradictions using multiple complementary techniques.

  • Meta-analysis approach: When sufficient data exists, conduct a formal meta-analysis of available results.

What bioinformatic approaches are most useful for predicting VCM66_1188 interactions and functions?

Comprehensive bioinformatic analysis of VCM66_1188 can provide valuable insights into potential functions and interactions, serving as a guide for experimental validation. For membrane proteins with limited characterization, computational approaches are particularly valuable.

An integrated bioinformatic workflow should include:

Analysis TypeToolsExpected OutcomesApplication to VCM66_1188
Sequence HomologyBLAST, HMMERIdentification of similar proteins with known functionsIdentify functional conservation across bacterial species
Structural PredictionSWISS-MODEL, I-TASSER3D structural modelsPredict membrane topology and functional domains
Protein-Protein InteractionSTRING, InterProScanPotential interaction partnersMap potential pathways involving VCM66_1188
Genomic ContextDOOR, GeConTGene neighborhood analysisIdentify operons and functionally related genes
Domain AnalysisPfam, SMARTFunctional domain identificationCharacterize the UPF0299 domain architecture

When evaluating the predictions generated through these tools, researchers should implement quasi-experimental analytical approaches to systematically test hypotheses . This allows for rigorous examination of predicted functions while acknowledging the inherent limitations of bioinformatic predictions.

How can single-case experimental designs enhance research on VCM66_1188's effects in cellular systems?

Single-case experimental designs offer valuable methodological frameworks for studying VCM66_1188's effects, particularly when working with limited samples or novel experimental conditions. These designs can provide strong internal validity for assessing causal relationships between interventions and outcomes, while also offering external validity for generalizing results .

For VCM66_1188 research, the following single-case designs are particularly applicable:

Incorporating randomization into these designs further improves internal validity. For example, researchers could randomize the order of intervention phases or the timing of phase transitions to control for potential order effects and carry-over influences .

What analytical techniques are most appropriate for studying post-translational modifications of VCM66_1188?

As a membrane protein, VCM66_1188 may undergo specific post-translational modifications that influence its localization, function, and interactions. Identifying and characterizing these modifications requires specialized analytical approaches.

The recommended methodological framework includes:

  • Mass spectrometry-based proteomics: Utilize techniques such as liquid chromatography-tandem mass spectrometry (LC-MS/MS) for comprehensive identification of modifications. This should include enrichment strategies specific to potential modification types (phosphorylation, glycosylation, etc.).

  • Site-directed mutagenesis: Systematically modify potential modification sites and assess functional consequences.

  • Modification-specific antibodies: Develop or utilize antibodies that specifically recognize modified forms of the protein.

  • Inhibitor studies: Apply inhibitors of specific modification enzymes to assess their impact on VCM66_1188 function.

When designing experiments to study post-translational modifications, researchers should consider implementing quasi-experimental designs that maximize internal validity while acknowledging practical constraints . These designs allow for meaningful inferences about the relationship between specific modifications and functional outcomes, even when randomized controlled trials are not feasible.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.