Recombinant Vibrio cholerae serotype O1 UPF0761 membrane protein VC0395_A2314/VC395_2854 (VC0395_A2314, VC395_2854)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag when possible.
Synonyms
VC0395_A2314; VC395_2854; UPF0761 membrane protein VC0395_A2314/VC395_2854
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-297
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Target Names
VC0395_A2314
Target Protein Sequence
MKLTHSFIKQQARLGLNFFRYLLARMNHDRVNVNAGYLAYITLLSMVPMLTVLLSILSSF ALFANAGEVIQDFVITHFVPAAGEVVKTALIEFVANTGKMTAVGGAFLFVAAIMLISNID KNLNYIWRVQQKRRAVFSFSMYWMILTLGPILVGASIAATSYITSLKILDNEALSGVYNL FLRWLPFVLSYCAFVGLYLLVPNKKVHWQHAMLGALIAAILFELSKKGFAAYITQFPSYQ LIYGALAAIPILFVWVYLCWLIVLVGAEVTAALGEREHWSDSQDMLHFAPLPKNEKE
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal expression systems for recombinant production of VC0395_A2314/VC395_2854?

The expression of recombinant Vibrio cholerae membrane proteins requires careful selection of expression systems. For VC0395_A2314/VC395_2854, researchers typically employ recombinant DNA techniques similar to those used for other V. cholerae membrane proteins. Using restriction enzyme fragments, genes encoding the target protein can be cloned into expression vectors and introduced into a V. cholerae strain of proven immunogenicity . When selecting an expression system, consider:

  • E. coli-based systems with specialized strains like BL21(DE3) or C41(DE3) for membrane protein expression

  • Homologous expression using attenuated V. cholerae strains

  • Cell-free expression systems for proteins that may be toxic to host cells

For optimal expression, control experiments comparing protein yields across different expression systems should be conducted, with detergent screening to identify conditions that maintain protein stability after extraction.

How can researchers effectively isolate and purify VC0395_A2314/VC395_2854 while maintaining protein integrity?

Isolation and purification of VC0395_A2314/VC395_2854 requires specialized techniques to maintain structural integrity. Based on approaches used for similar membrane proteins:

  • Membrane Fraction Isolation: Perform cell lysis followed by differential centrifugation to isolate membrane fractions

  • Detergent Screening: Test a panel of mild detergents (DDM, LDAO, OG) for efficient solubilization

  • Chromatography Selection: Employ sequential purification using:

    • Affinity chromatography (His-tag or custom antibody-based)

    • Size exclusion chromatography for final polishing

  • Stability Assessment: Monitor protein stability through dynamic light scattering and thermal shift assays

To preserve the native conformation, consider incorporating the protein into nanodiscs or liposomes after purification, similar to approaches used for other outer membrane proteins of V. cholerae .

What structural analysis techniques are most appropriate for characterizing VC0395_A2314/VC395_2854?

Structural characterization of VC0395_A2314/VC395_2854 can be approached through multiple complementary techniques:

When designing structural studies, researchers should employ a multi-technique approach, starting with circular dichroism for initial secondary structure assessment, followed by more advanced techniques for detailed structural analysis . For membrane proteins like VC0395_A2314/VC395_2854, lipid composition during reconstitution significantly impacts structural integrity and should be systematically optimized.

How do researchers address data contradictions between in vitro binding studies and in vivo functional assays of VC0395_A2314/VC395_2854?

When confronting contradictory data between in vitro binding studies and in vivo functional assays of VC0395_A2314/VC395_2854, researchers should implement a systematic approach:

  • Validate Expression Systems: Confirm that the protein maintains native conformation in both study types by using multiple antibodies targeting different epitopes

  • Control for Cofactors: Assess whether binding partners present in vivo but absent in vitro might explain functional differences

  • Design Quasi-experimental Studies: Implement removed-treatment designs (where the protein is initially present, then removed) to establish causality between protein presence and observed effects

  • Address Confounding Variables: Control for factors like lipopolysaccharide interaction, as membrane proteins often function in coordination with other membrane components

For robust reconciliation of contradictory data, implement a framework that:

  • Tests protein functionality in concentration gradients

  • Examines protein-protein interactions in complex membrane environments

  • Utilizes site-directed mutagenesis to identify critical functional residues

  • Compares results across multiple V. cholerae strains to control for strain-specific effects

What methodologies effectively elucidate the role of VC0395_A2314/VC395_2854 in bacterial pathogenesis?

To determine the role of VC0395_A2314/VC395_2854 in pathogenesis, researchers should employ multi-faceted approaches:

  • Genetic Manipulation Strategies:

    • Generate clean deletion mutants using allelic exchange

    • Create point mutations in predicted functional domains

    • Develop complementation strains to confirm phenotype specificity

  • Infection Models:

    • Infant mouse colonization model to assess in vivo fitness

    • Human intestinal organoid systems for host-pathogen interactions

    • Competitive index assays comparing wild-type and mutant strains

  • Molecular Interaction Studies:

    • Pull-down assays to identify host receptors

    • Surface plasmon resonance to quantify binding kinetics

    • Cross-linking studies to capture transient interactions

When designing these experiments, researchers should implement appropriate controls including using multiple V. cholerae strains to ensure observed phenotypes are not strain-specific . Statistical analysis should account for biological variability by employing sufficient biological replicates (minimum n=3) and appropriate statistical tests based on data distribution.

How can researchers design experiments to assess potential interactions between VC0395_A2314/VC395_2854 and other outer membrane components?

To investigate interactions between VC0395_A2314/VC395_2854 and other membrane components, researchers should implement a systematic experimental design:

  • In Silico Analysis:

    • Protein-protein interaction predictions based on structural modeling

    • Identification of potential binding domains through sequence analysis

  • Biochemical Verification:

    • Co-immunoprecipitation with antibodies against candidate interacting proteins

    • Blue native PAGE to preserve membrane protein complexes

    • Chemical cross-linking followed by mass spectrometry (XL-MS)

  • In Vivo Validation:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Förster resonance energy transfer (FRET) between fluorescently labeled proteins

    • Super-resolution microscopy to observe co-localization

When studying interactions with lipopolysaccharides, researchers should consider the possibility that both outer membrane proteins and oligosaccharide components may serve as co-receptors for bacteriophages, as observed with TolC . This experimental paradigm can provide insights into functional relationships between different membrane components.

What are the most robust approaches for analyzing the immunogenicity of VC0395_A2314/VC395_2854 for potential vaccine development?

To assess the immunogenicity of VC0395_A2314/VC395_2854 for vaccine development, researchers should implement a comprehensive evaluation strategy:

  • Epitope Mapping:

    • In silico prediction of B-cell and T-cell epitopes

    • Peptide array screening with sera from convalescent patients

    • Hydrogen/deuterium exchange mass spectrometry to identify exposed regions

  • Immunological Assessment:

    • ELISA to quantify antibody responses in animal models

    • ELISpot assays to enumerate antigen-specific T cells

    • Flow cytometry to characterize cellular immune responses

  • Protection Studies:

    • Challenge experiments in appropriate animal models

    • Passive transfer of antibodies to assess protection mechanisms

    • Mucosal immunity evaluation through secretory IgA measurement

When developing recombinant protein-based vaccines, researchers should consider that previous studies indicate toxoid-derived antitoxic immunity alone is insufficient for effective, long-lasting protection against cholera . Therefore, combining VC0395_A2314/VC395_2854 with other protective antigens may be necessary for robust immunity.

How can researchers effectively apply vesicle isolation techniques to study VC0395_A2314/VC395_2854 in its native environment?

Membrane vesicles provide an excellent system to study proteins like VC0395_A2314/VC395_2854 in a near-native environment. To effectively apply vesicle isolation techniques:

  • Isolation Protocol Optimization:

    • Differential ultracentrifugation with density gradient purification

    • Filtration steps to remove cellular debris and contaminants

    • Verification of vesicle integrity through electron microscopy

  • Characterization Approaches:

    • Proteomic analysis using mass spectrometry to confirm protein presence

    • Western blotting with specific antibodies to quantify relative abundance

    • Dynamic light scattering to assess vesicle size distribution

  • Functional Assessment:

    • Binding assays with potential interaction partners

    • Transport studies if VC0395_A2314/VC395_2854 is predicted to have transporter activity

    • Lipidomic analysis to characterize the lipid environment

When isolating vesicles from V. cholerae, researchers should be aware that both double- and single-membrane vesicle structures exist , which may affect the orientation and functionality of the embedded proteins. Control experiments should verify protein orientation using protease accessibility assays.

What experimental controls are essential when performing site-directed mutagenesis to identify functional domains of VC0395_A2314/VC395_2854?

Site-directed mutagenesis studies require careful experimental design and controls:

When analyzing the impact of mutations, researchers should consider examples from similar proteins like TolC, where specific amino acid residues (positions 78, 290, and 291) in the outside loops are critical for function . This approach can help identify functionally important domains in VC0395_A2314/VC395_2854.

How should researchers interpret conflicting data regarding the function of VC0395_A2314/VC395_2854 across different V. cholerae strains?

When confronted with strain-specific variations in VC0395_A2314/VC395_2854 function:

  • Systematic Strain Comparison:

    • Sequence the gene across multiple strains to identify polymorphisms

    • Create phylogenetic trees to correlate sequence variations with functional differences

    • Perform complementation studies with variants from different strains

  • Environmental Context Analysis:

    • Assess protein function under varying conditions (pH, osmolarity, nutrient availability)

    • Evaluate interaction with strain-specific membrane components

    • Consider horizontal gene transfer history that might affect protein function

  • Statistical Approach:

    • Implement quasi-experimental designs with multiple pre- and post-intervention measurements

    • Use non-equivalent dependent variables to control for confounding factors

    • Apply appropriate statistical tests accounting for strain variations

When analyzing strain-specific differences, researchers should consider that mutations in surface-exposed regions of membrane proteins can significantly alter function, as observed in TolC variants that confer phage resistance . These principles can help explain functional variations of VC0395_A2314/VC395_2854 across different strains.

What bioinformatic approaches best predict structure-function relationships for VC0395_A2314/VC395_2854?

For comprehensive structure-function prediction of VC0395_A2314/VC395_2854:

  • Structure Prediction:

    • Utilize AlphaFold2 or RoseTTAFold for ab initio modeling

    • Perform molecular dynamics simulations in membrane environments

    • Validate models through comparison with experimental data

  • Functional Domain Identification:

    • Apply conserved domain database searches

    • Conduct evolutionary trace analysis to identify functionally important residues

    • Implement machine learning approaches trained on known membrane protein functions

  • Interaction Prediction:

    • Molecular docking to predict binding partners

    • Coevolution analysis to identify potential interaction interfaces

    • Protein-protein interaction network construction

When applying these approaches, researchers should integrate experimental validation at each step, as computational predictions alone may not capture the complexity of membrane protein interactions in the bacterial outer membrane environment.

What are the most promising future research directions for understanding the role of VC0395_A2314/VC395_2854 in bacterial physiology and pathogenesis?

Future research on VC0395_A2314/VC395_2854 should focus on:

  • Systems Biology Integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Network analysis to position VC0395_A2314/VC395_2854 within cellular pathways

    • Synthetic biology approaches to create minimal systems for functional validation

  • Advanced Structural Biology:

    • Time-resolved structural studies to capture conformational changes

    • In-cell structural biology to observe the protein in its native environment

    • Integration of computational and experimental approaches for dynamic modeling

  • Translational Applications:

    • Evaluation as a diagnostic biomarker for specific V. cholerae strains

    • Assessment as a vaccine antigen component

    • Exploration as a target for novel antibacterial compounds

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.