Recombinant Vibrio cholerae serotype O1 UPF0761 membrane protein VCD_001626 (VCD_001626)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Vibrio cholerae serotype O1 UPF0761 membrane protein VCD_001626 (UniProt ID: C3NUE6) is a 297-amino-acid polypeptide expressed in Escherichia coli with an N-terminal His tag for purification . This full-length protein belongs to the UPF0761 family of membrane-associated proteins, which are implicated in bacterial membrane integrity and potential host-pathogen interactions .

Functional Insights

While the exact biological role of VCD_001626 remains under investigation, its classification as a membrane protein suggests potential involvement in:

  • Membrane transport (e.g., nutrient uptake or efflux) .

  • Structural stabilization of the outer membrane in V. cholerae .

  • Immune evasion mechanisms, common in pathogenic Vibrio species .

Notably, UPF0761 family proteins are linked to bacterial survival under osmotic stress, a critical factor in V. cholerae’s environmental persistence .

Antibody Development

VCD_001626 serves as an antigen in vaccine research due to its surface exposure in V. cholerae. Studies utilize lipoparticle-displayed membrane proteins for kinetic antibody-binding assays, as demonstrated in CXCR4 interaction models .

Hybrid Protein Engineering

Combined with plant-based proteins, recombinant VCD_001626 could enhance texture in alternative protein products, though this application remains exploratory .

Comparative Analysis With Related Proteins

ProteinVCD_001626 (O1)MJ-1236 Strain Variant
SourceSerotype O1Strain MJ-1236
Expression HostE. coliE. coli/Yeast/Baculovirus
TagHis tagUnspecified
Documented UseStructural studiesVaccine development

Challenges in Study

  • Membrane Integration: Hydrophobic regions complicate solubilization without detergents .

  • Conformational Stability: Requires lipid bilayers or lipoparticles for functional assays .

Future Directions

  • Pathogenicity Studies: Link VCD_001626 to cholera toxin regulation or biofilm formation .

  • Drug Targeting: Exploit its membrane localization for antimicrobial peptide design .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference in the order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution. Store at -20°C or -80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of our products depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize its implementation during development.
Synonyms
VCD_001626; UPF0761 membrane protein VCD_001626
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-297
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain MJ-1236)
Target Names
VCD_001626
Target Protein Sequence
MKLTHSFIKQQARLGLNFFRYLLARMNHDRVNVNAGYLAYITLLSMVPMLTVLLSILSSF ALFANAGEVIQDFVITHFVPAAGEVVKTALIEFVANTGKMTAVGGAFLFVAAIMLISNID KNLNYIWRVQQKRRAVFSFSMYWMILTLGPILVGASIAATSYITSLKILDNEALSGVYNL FLRWLPFVLSYCAFVGLYLLVPNKKVHWQHAMLGALIAAILFELSKKGFAAYITQFPSYQ LIYGALAAIPILFVWVYLCWLIVLVGAEVTAALGEREHWSDSQDMLHFAPLPKNEKE
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of VCD_001626?

VCD_001626 is a 297-amino acid protein belonging to the UPF0761 family of membrane proteins expressed in Vibrio cholerae serotype O1. The protein contains multiple transmembrane domains as indicated by its hydrophobic amino acid sequence profile. The full amino acid sequence is: MKLTHSFIKQQARLGLNFFRYLLARMNHDRVNVNAGYLAYITLLSMVPMLTVLLSILSSFALFANAGEVIQDFVITHFVPAAGEVVKTALIEFVANTGKMTAVGGAFLFVAAIMLISNIDKNLNYIWRVQQKRRAVFSFSMYWMILTLGPILVGASIAATSYITSLKILDNEALSGVYNLFLRWLPFVLSYCAFVGLYLLVPNKKVHWQHAMLGALIAAILFELSKKGFAAYITQFPSYQLIYGALAAIPILFVWVYLCWLIVLVGAEVTAALGEREHWSDSQDMLHFAPLPKNEKE . This sequence contains multiple hydrophobic regions consistent with transmembrane domains, suggesting it spans the membrane multiple times.

What are the optimal expression systems for recombinant VCD_001626?

Recombinant VCD_001626 has been successfully expressed in E. coli expression systems with an N-terminal His-tag fusion . For optimal expression, researchers should consider the following methodology: Use BL21(DE3) or similar E. coli strains designed for membrane protein expression. Induction conditions should be optimized at lower temperatures (16-20°C) to prevent inclusion body formation, and expression should be performed with reduced IPTG concentrations (0.1-0.5mM) to slow protein production and allow proper membrane insertion. Adding glycerol (5-10%) to the culture medium can enhance membrane protein stability. For purification, detergent screening is essential, with common choices including n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin depending on downstream applications .

How does VCD_001626 relate to other membrane proteins in V. cholerae?

V. cholerae expresses several significant membrane proteins, including major outer membrane proteins (MOMPs) with molecular masses ranging from 20 to 50 kDa that play crucial roles in virulence and host interaction . While VCD_001626's specific relationship to these proteins has not been fully characterized, it likely contributes to the complex membrane architecture of V. cholerae. Unlike the well-studied OmpV, OmpK, and OmpU proteins that have demonstrated roles in immune response and protection against V. cholerae challenge, VCD_001626 remains less characterized . Research methodologies to investigate these relationships should include co-immunoprecipitation studies, bacterial two-hybrid systems, and proximity labeling approaches to identify protein-protein interactions within the membrane environment.

What techniques are most effective for studying VCD_001626 topology and membrane orientation?

For determining VCD_001626 membrane topology, researchers should implement multiple complementary approaches. Cysteine scanning mutagenesis coupled with thiol-reactive reagents can identify exposed residues. This involves creating a cysteine-free version of VCD_001626, then introducing individual cysteines at different positions and testing their accessibility to membrane-impermeable reagents. GFP-fusion reporter assays where GFP is fused to different termini or loops can indicate cytoplasmic localization (where GFP fluorescence is preserved) versus periplasmic localization (where GFP typically fails to fold properly). Protease protection assays involving treatment of membrane vesicles with proteases followed by mass spectrometry analysis can identify protected versus exposed regions. Additionally, cryo-electron microscopy represents the gold standard for detailed structural analysis but requires highly purified and stable protein preparations .

How can researchers investigate potential roles of VCD_001626 in V. cholerae pathogenesis?

To investigate VCD_001626's role in pathogenesis, researchers should employ a systematic approach combining genetic manipulation and functional assays. First, generate clean deletion mutants (ΔVCD_001626) in virulent V. cholerae strains using allelic exchange techniques. Complementation studies with the wild-type gene should be performed to confirm phenotypic changes. Analyze colonization ability using infant mouse models and intestinal epithelial cell adhesion assays to compare wild-type and mutant strains. Perform transcriptomic analysis (RNA-Seq) comparing wild-type and ΔVCD_001626 strains under infection-relevant conditions to identify affected pathways. Investigate potential interactions with known virulence factors using co-immunoprecipitation or bacterial two-hybrid systems. Consider the protein's potential involvement in membrane vesicle formation, which can transport virulence factors and genetic material, by analyzing vesicle production in wild-type versus mutant strains .

What approaches can identify potential interaction partners of VCD_001626?

Multiple methodologies can elucidate VCD_001626 interaction partners. Bacterial two-hybrid screening represents an initial approach to identify potential protein-protein interactions, particularly for membrane proteins. In vivo crosslinking followed by immunoprecipitation and mass spectrometry analysis (XL-MS) can capture transient or weak interactions within the native membrane environment. Proximity-dependent biotin labeling techniques (BioID or TurboID) where the protein is fused to a biotin ligase can identify proximal proteins in living cells. Blue native PAGE coupled with western blotting can identify stable membrane protein complexes containing VCD_001626. For mapping specific interaction domains, truncation mutants and site-directed mutagenesis should be employed, followed by binding assays with identified partners .

What are the critical parameters for successful purification of recombinant VCD_001626?

Successful purification of VCD_001626 requires careful optimization of multiple parameters. Initial extraction from bacterial membranes requires screening of detergents (DDM, OG, LDAO, etc.) for optimal solubilization while maintaining protein stability and function. For His-tagged constructs, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin should be performed under gentle conditions (low imidazole in wash buffers, typically 20-40mM) to prevent non-specific binding while maintaining protein integrity. Size exclusion chromatography as a polishing step helps achieve higher purity and assess protein oligomeric state. Throughout purification, detergent concentration must remain above critical micelle concentration (CMC) to prevent protein aggregation. For long-term storage, researchers should evaluate glycerol addition (typically 10-20%) and cryoprotectants to prevent freeze-thaw damage. Quality assessment should include SDS-PAGE, western blotting, and dynamic light scattering to evaluate purity and homogeneity .

How can researchers develop antibodies specific to VCD_001626?

Development of VCD_001626-specific antibodies requires strategic epitope selection and validation procedures. Begin by performing computational analysis to identify antigenic regions, focusing on hydrophilic loops predicted to be exposed outside the membrane. Synthesize peptides corresponding to these regions (typically 15-20 amino acids) or express recombinant fragments of hydrophilic domains. For polyclonal antibody production, immunize rabbits or mice with purified recombinant protein or KLH-conjugated peptides using standard immunization protocols with appropriate adjuvants. For monoclonal antibody development, screen hybridoma supernatants against both recombinant protein and V. cholerae membrane preparations. Critical validation steps include western blotting against wild-type and ΔVCD_001626 strains, immunofluorescence microscopy to confirm membrane localization, and pre-adsorption controls to demonstrate specificity. Cross-reactivity testing against related Vibrio species provides information about epitope conservation .

What functional assays can determine the physiological role of VCD_001626?

Multiple functional assays can help elucidate VCD_001626's physiological role. Growth curve analysis of wild-type versus ΔVCD_001626 strains under various stress conditions (osmotic, pH, bile salts) can reveal roles in stress resistance. Membrane integrity assays using fluorescent dyes (SYTOX Green, propidium iodide) can identify potential roles in membrane permeability. Nutrient uptake assays with radiolabeled or fluorescently labeled substrates might reveal transport functions. Biofilm formation assays using crystal violet staining or confocal microscopy can identify roles in community behavior. Vesicle production quantification and characterization in wild-type versus mutant strains can demonstrate potential roles in membrane vesicle biology, which is particularly relevant given V. cholerae's known vesicle-mediated DNA transfer capabilities . Proteomic analysis of membrane fractions from wild-type versus mutant strains can reveal changes in membrane protein composition that might suggest functional relationships.

How conserved is VCD_001626 across different Vibrio species and strains?

VCD_001626 conservation analysis provides insight into evolutionary importance and potential function. Researchers should perform comprehensive sequence alignment of VCD_001626 homologs across multiple Vibrio species, particularly pathogenic and non-pathogenic variants. Analysis typically reveals higher conservation in transmembrane domains versus loop regions, consistent with structural constraints of membrane insertion. Phylogenetic analysis should be conducted to correlate VCD_001626 sequence variations with pathogenicity, geographic distribution, or environmental adaptation. The conservation pattern within serotype O1 strains versus non-O1 strains may provide insights into potential roles in virulence. For experimental validation of functional conservation, complementation studies using homologs from different species in a ΔVCD_001626 V. cholerae background can determine functional equivalence. Positive selection analysis (dN/dS ratio calculation) can identify residues under evolutionary pressure, potentially highlighting functionally important regions .

What is the potential relationship between VCD_001626 and membrane vesicle formation?

Given V. cholerae's production of membrane vesicles containing DNA and proteins, VCD_001626 may play a role in this process. Researchers should quantify and characterize vesicle production in wild-type versus ΔVCD_001626 strains using techniques such as nanoparticle tracking analysis, electron microscopy, and proteomics. The protein content of vesicles should be analyzed by mass spectrometry to determine if VCD_001626 is incorporated into vesicles, which would suggest direct involvement in vesicle structure. DNA content analysis of vesicles from wild-type versus mutant strains can reveal potential roles in DNA packaging, particularly important given that V. cholerae vesicles contain AT-rich DNA fragments and specific mRNAs . Fluorescence microscopy using VCD_001626-fluorescent protein fusions can visualize potential localization to vesicle formation sites. Chromatin immunoprecipitation followed by sequencing (ChIP-seq) using tagged VCD_001626 can identify any DNA-binding capability that might contribute to DNA selection for vesicle packaging .

How does VCD_001626 compare to other UPF0761 family proteins?

The UPF0761 family (Uncharacterized Protein Family 0761) represents a group of membrane proteins with largely unknown functions. Comparative analysis should begin with sequence alignment of UPF0761 members from diverse bacterial species to identify highly conserved residues that might indicate functional importance. Structural prediction algorithms should be employed to compare predicted transmembrane topology and potential functional sites. Genomic context analysis examining neighboring genes across species can provide functional clues through guilt-by-association principles. Literature mining for any characterized UPF0761 family members in other bacteria might provide functional insights applicable to VCD_001626. Researchers should consider heterologous expression studies where UPF0761 family members from other species are expressed in the ΔVCD_001626 V. cholerae background to test functional complementation. This comparative approach provides evolutionary context and may reveal conserved functions across bacterial species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.