Recombinant Vibrio cholerae serotype O1 Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase (vibE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
vibE; VC_0772; Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase; Dihydroxybenzoic acid-activating enzyme
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-543
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Target Names
vibE
Target Protein Sequence
MTTDFTPWPEALAAQYRQLGYWQDKTLLDYLQQSAERTPNALALVGDNQQWRYQAMLERI EQLAAGFTELGLGCGDNVVLQLGNVAEFYLCFFALLRQGIRPILALPAHRLAEIRYFCQH SQAKAYLIDGAQRPFDYQALAQELLACCPTLQTVIVRGQTRVTDPKFIELASCYSASSCQ ANADPNQIAFFQLSGGTTGTPKLIPRTHNDYAYSVTASVEICRFDQHTRYLCVLPAAHNF PLSSPGALGVFWAGGCVVLSQDASPQHAFKLIEQHKITVTALVPPLALLWMDHAEKSTYD LSSLHFVQVGGAKFSEAAARRLPKALGCQLQQVFGMAEGLVNYTRLDDSAELIATTQGRP ISAHDQLLVVDEQGQPVASGEEGYLLTQGPYTIRGYYRADQHNQRAFNAQGFYITGDKVK LSSEGYVIVTGRAKDQINRGGEKIAAEEVENQLLHHPAVHDAALIAISDEYLGERSCAVI VLKPEQSVNTIQLKRFLHQAGLADYKIPDQIQFIDQLPKTSVGKIDKNALRRRFDTLGLA LMS
Uniprot No.

Target Background

Function
This protein catalyzes the ATP-dependent activation of 2,3-dihydroxybenzoate (DHB) carboxylate group to its acyladenylate form, a crucial step in vibriobactin biosynthesis.
Database Links

KEGG: vch:VC0772

STRING: 243277.VC0772

Protein Families
ATP-dependent AMP-binding enzyme family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the biochemical function of VibE in Vibrio cholerae?

VibE is a vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase that catalyzes a critical step in vibriobactin biosynthesis. Specifically, VibE activates 2,3-dihydroxybenzoate (2,3-DHB) by adenylation to form 2,3-DHB-AMP, which is subsequently transferred to the aryl carrier protein domain of holo VibB. This reaction is part of the vibriobactin synthetase (VibABCDEFH) pathway that catalyzes the biosynthesis of vibriobactin, which is essential for iron acquisition in iron-limited environments . This function places VibE within the broader context of non-ribosomal peptide synthetase (NRPS) systems that are crucial for bacterial siderophore production.

How does VibE relate to the pathogenesis of Vibrio cholerae?

VibE contributes to V. cholerae pathogenesis through its role in iron acquisition. During infection, the human host restricts iron availability as a defense mechanism, maintaining extremely low free iron concentrations. V. cholerae counters this nutritional immunity through vibriobactin production, which has an extremely high affinity for Fe³⁺. As a key enzyme in vibriobactin biosynthesis, VibE enables the pathogen to acquire iron in the iron-limited host environment, supporting bacterial growth and virulence factor production. Studies with vibE-deficient mutants demonstrate attenuated virulence in animal models and reduced growth in iron-limited media, highlighting its importance in pathogenesis .

What is known about the structure of VibE?

X-ray crystallographic studies have determined the structure of VibE at 2.3 Å resolution. The crystal belongs to space group P2₁, with unit-cell parameters a = 56.471, b = 45.927, c = 77.014 Å, β = 95.895°. There is one protein molecule in the asymmetric unit, with a corresponding Matthews coefficient of 1.63 ų Da⁻¹ and solvent content of 24.41% . Structurally, VibE belongs to the ANL (Acyl-CoA synthetases, Non-ribosomal peptide synthetase adenylation domains, and Luciferase) superfamily of adenylating enzymes. The protein likely has distinct N-terminal and C-terminal domains connected by a flexible hinge region, which allows for conformational changes during catalysis.

What are the optimal conditions for expression and purification of recombinant VibE?

For successful expression and purification of recombinant VibE, researchers have reported the following methodology:

  • Cloning and Expression System:

    • The vibE gene is cloned from V. cholerae genomic DNA into an expression vector (such as pET series vectors) .

    • Expression in E. coli BL21(DE3) strains is typically effective.

  • Expression Conditions:

    • Induction with IPTG (typically 0.5-1.0 mM) at mid-log phase (OD₆₀₀ ~0.6-0.8).

    • Incubation at lower temperatures (18-25°C) for extended periods (16-20 hours) helps minimize inclusion body formation.

  • Purification Strategy:

    • Initial purification via affinity chromatography (His-tag or GST-tag approaches).

    • Further purification using ion-exchange chromatography and size-exclusion chromatography.

    • Buffer optimization is crucial, with typical conditions including 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, and additives like glycerol and reducing agents.

This systematic approach has yielded protein of sufficient purity and quantity for crystallographic studies .

What methodologies are effective for crystallizing VibE for structural studies?

Based on the successful crystallization reported in the literature, the following methodology has proven effective for VibE crystallization:

  • Crystallization Method:

    • Hanging-drop vapor diffusion method at 20°C .

    • Mixing purified protein (typically at 10-15 mg/ml) with reservoir solution in a 1:1 ratio.

  • Successful Crystallization Conditions:

    • Buffer conditions around pH 6.5-7.0 (e.g., 0.1 M Bis-Tris).

    • Precipitant concentrations of 15-25% PEG 3350.

    • Addition of salts such as ammonium sulfate or lithium sulfate.

  • Crystal Handling for Diffraction Studies:

    • Crystals appear within 5-7 days and can be flash-frozen in liquid nitrogen.

    • Cryoprotection using mother liquor supplemented with 20-25% glycerol or ethylene glycol.

    • Diffraction data collection performed at synchrotron radiation sources.

The successful crystallization yielded crystals that diffracted to 2.3 Å resolution, allowing determination of the structure .

How can enzyme activity of VibE be reliably measured in laboratory settings?

Several complementary approaches can be used to measure VibE activity with high reliability:

  • ATP-[³²P]PPi Exchange Assay:

    • This radioactive assay measures the incorporation of [³²P]PPi into ATP in the reverse reaction catalyzed by VibE.

    • Reaction mixture typically contains Tris-HCl buffer (pH 7.5), MgCl₂, ATP, 2,3-DHB, [³²P]PPi, and purified VibE.

    • ATP is separated from reaction mixture using activated charcoal, and radioactivity is measured.

    • This is considered the gold standard for adenylation domain activity determination.

  • Pyrophosphate (PPi) Release Assay:

    • Measures the release of PPi during the adenylation reaction.

    • Can be coupled with inorganic pyrophosphatase and colorimetric detection of phosphate.

    • Alternative coupling with continuous enzymatic assays that link PPi production to NAD(P)H oxidation.

  • AMP Formation Assay:

    • Measures production of AMP as VibE catalyzes adenylation of 2,3-DHB.

    • Can be coupled with myokinase, pyruvate kinase, and lactate dehydrogenase.

    • Monitors NADH oxidation spectrophotometrically at 340 nm.

For all assays, optimization of pH (typically 7.0-8.0), temperature (25-37°C), enzyme concentration, and substrate concentrations is essential for reliable results.

How does VibE specificity for 2,3-dihydroxybenzoate compare with related adenylation domains?

VibE demonstrates high specificity for 2,3-dihydroxybenzoate through several structural features:

  • Specificity-Determining Residues:

    • A hydrophobic binding pocket accommodates the aromatic ring of 2,3-DHB.

    • Specific hydrogen bonding interactions with the 2- and 3-hydroxyl groups.

    • Interactions with the carboxyl group through positively charged residues.

  • Comparative Analysis with Related Enzymes:

    • VibE shows structural similarity to EntE from E. coli (another 2,3-DHB-AMP ligase) but differs significantly from salicylate-activating enzymes like YbtE from Yersinia pestis.

    • The substrate binding pocket of VibE is optimized specifically for 2,3-DHB recognition.

  • Substrate Specificity Profile:

    • VibE shows highest activity with 2,3-DHB.

    • Significantly reduced activity with 2,5-DHB, 3,4-DHB, and salicylic acid.

    • Virtually no activity with non-aromatic substrates.

This high specificity is biologically significant as it ensures the correct building block is incorporated into vibriobactin, maintaining siderophore function .

What is the impact of O1 serotype variation on VibE structure and function?

The impact of O1 serotype variation on VibE appears minimal based on current evidence:

  • Serotype Definition in V. cholerae:

    • V. cholerae O1 serogroup is divided into Ogawa and Inaba serotypes .

    • These serotypes differ primarily by the presence or absence of a terminally methylated O-antigen rather than in proteins like VibE.

  • VibE Conservation Across Serotypes:

    • Genomic analyses suggest high conservation (>95% sequence identity) of vibE across clinical and environmental V. cholerae O1 isolates.

    • Critical catalytic and substrate-binding residues show near-complete conservation.

  • Functional Implications:

    • The high conservation of vibE suggests that its function is essential regardless of serotype.

    • Both Ogawa and Inaba serotypes require functional iron acquisition systems for virulence.

  • Research Applications:

    • The conservation of VibE across serotypes makes it a potential universal target for anti-virulence strategies.

    • Vaccine development studies have found that serotype variations do not significantly impact iron acquisition systems .

This conservation highlights the evolutionary pressure to maintain functional iron acquisition systems in pathogenic V. cholerae strains.

How does horizontal gene transfer influence vibE evolution in Vibrio cholerae populations?

Horizontal gene transfer (HGT) has several notable impacts on vibE evolution in V. cholerae populations:

  • T6SS-Mediated DNA Acquisition:

    • V. cholerae can acquire DNA fragments exceeding 150 kbp through Type VI secretion system (T6SS)-mediated killing of neighboring bacteria .

    • This mechanism allows for substantial genetic exchange, potentially including virulence factors and metabolic genes.

  • Recombination Event Size:

    • Studies show that competent V. cholerae can acquire DNA fragments with a length exceeding 150 kbp in a T6SS-dependent manner .

    • The mean observed recombination event size can be more than 50 kbp, or approximately 50 genes, which is significantly larger than recombination events in other bacteria like Streptococcus pneumoniae (mean ~4 kbp) .

  • Functional Constraints:

    • Despite the potential for HGT, functional constraints on VibE activity likely limit the fixation of transferred alleles that significantly alter enzyme function.

    • Critical catalytic residues show high conservation, suggesting purifying selection.

  • Evolutionary Implications:

    • The environmental lifestyle of V. cholerae fosters genetic exchange with sufficient coding capacity to significantly accelerate bacterial evolution .

    • This may contribute to the diversity observed in V. cholerae populations in cholera-endemic areas.

These findings contradict the notion that natural transformation is unlikely to serve for the acquisition of new genetic information due to quick fragmentation of free DNA in natural environments .

How can structural knowledge of VibE be applied to rational inhibitor design?

The structural information about VibE enables several approaches for rational inhibitor design:

  • Structure-Based Virtual Screening:

    • The crystal structure of VibE at 2.3 Å resolution provides detailed insights into the ATP and 2,3-DHB binding pockets .

    • Virtual screening of compound libraries can identify molecules with favorable binding energies to these sites.

  • Target Site Selection:

    • Active site targeting: Competitive inhibitors can be designed to mimic either ATP or 2,3-DHB.

    • Allosteric site targeting: Inhibitors can be designed to disrupt the conformational changes necessary for catalysis.

    • Protein-protein interaction disruption: Molecules that interfere with VibE-VibB interactions could block the transfer of the activated 2,3-DHB.

  • Rational Design Strategies:

    • Substrate analogs: 2,3-DHB analogs with modifications that enhance binding but prevent adenylation.

    • Transition state mimics: Compounds that resemble the geometry and charge distribution of the reaction's transition state.

    • Bisubstrate inhibitors: Molecules that simultaneously occupy both ATP and 2,3-DHB binding sites.

  • Methodological Approach:

    • Iterative cycles of computational design, chemical synthesis, enzymatic assays, and structural analysis.

    • Verification of binding mode through co-crystallization studies.

    • Assessment of specificity by testing against related adenylation enzymes.

This approach could yield selective inhibitors of VibE that could serve as anti-virulence agents against V. cholerae infections.

What methodological approaches can resolve contradictions in VibE research findings?

Resolving contradictions in VibE research findings requires systematic methodological approaches:

  • Standardization of Experimental Conditions:

    • Establish consistent protocols for protein expression, purification, and activity assays.

    • Define standard reaction conditions (pH, temperature, buffer composition, etc.).

    • Create reference standards for activity measurements.

  • Multi-Method Validation:

    • Apply multiple independent techniques to measure the same parameter.

    • For enzyme kinetics, compare results from different assay methods (e.g., PPi release, ATP-[³²P]PPi exchange).

    • Validate structural findings with both X-ray crystallography and solution-based methods like NMR or SAXS.

  • Addressing Strain Variability:

    • When comparing results across studies, account for genetic differences between V. cholerae strains.

    • Create isogenic strains that differ only in the parameter being studied.

    • This approach has been effective in studying serotype variations, where matched variants were engineered to evaluate immunogenicity and protective efficacy .

  • Statistical Rigor:

    • Perform power analyses to determine appropriate sample sizes.

    • Use robust statistical methods appropriate for the data distribution.

    • Report effect sizes and confidence intervals, not just p-values.

  • Systematic Review Methodology:

    • Meta-analysis of published data with clear inclusion criteria.

    • Assessment of study quality and risk of bias.

    • Identification of moderator variables that might explain contradictory findings.

This methodological framework can help resolve contradictions and establish consensus in VibE research.

What statistical approaches are most appropriate for analyzing VibE enzyme kinetics data?

The analysis of VibE enzyme kinetics data requires specific statistical approaches:

  • Model Selection for Kinetic Data:

    • Michaelis-Menten equation: For simple kinetics following hyperbolic behavior.

    • Hill equation: When evidence of cooperativity exists.

    • Competitive/non-competitive inhibition models: For inhibitor studies.

    • Model selection should be guided by Akaike Information Criterion (AIC) or similar metrics.

  • Parameter Estimation Methods:

    • Non-linear regression: Direct fitting to the appropriate kinetic model.

    • Linear transformations: Traditional methods like Lineweaver-Burk plots are useful for visual inspection but prone to error magnification.

    • Global fitting: Simultaneous fitting of multiple datasets with shared parameters.

  • Proper Error Analysis:

    • Monte Carlo simulations: To generate confidence intervals for kinetic parameters.

    • Bootstrap resampling: To assess the robustness of parameter estimates.

    • Residual analysis: To validate model assumptions.

  • Comparative Statistics for Experimental Conditions:

    • Analysis of Variance (ANOVA): To compare kinetic parameters across multiple conditions.

    • Post-hoc tests: Tukey's HSD or Bonferroni correction for multiple comparisons.

    • Non-parametric alternatives: When normality assumptions are violated.

  • Presentation of Kinetic Data:

    • Report both Km and kcat values with confidence intervals.

    • Include full dataset visualization rather than just transformed plots.

    • Present residual plots to demonstrate goodness of fit.

This systematic statistical approach ensures reliable interpretation of enzyme kinetic data and facilitates comparison across studies.

How should researchers design experiments to investigate VibE-VibB protein-protein interactions?

Investigating VibE-VibB protein-protein interactions requires carefully designed experiments:

  • Binding Assays:

    • Surface Plasmon Resonance (SPR):

      • Immobilize either VibE or VibB on a sensor chip.

      • Measure association and dissociation kinetics with varying concentrations.

      • Determine binding affinity (KD) and kinetic parameters (kon, koff).

    • Isothermal Titration Calorimetry (ITC):

      • Directly measure thermodynamic parameters (ΔH, ΔS, ΔG).

      • No protein modification or immobilization required.

      • Provides stoichiometry information.

  • Structural Studies:

    • Co-crystallization attempts:

      • Optimize conditions for forming stable VibE-VibB complexes.

      • Screen multiple crystallization conditions.

      • Consider crosslinking approaches if the interaction is transient.

    • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

      • Map interaction interfaces without requiring crystal formation.

      • Compare deuterium uptake in free and complexed proteins.

  • Functional Assays:

    • Coupled enzyme assays:

      • Monitor the complete reaction from 2,3-DHB adenylation to transfer onto VibB.

      • Compare activity with varying concentrations of both proteins.

    • FRET-based assays:

      • Label VibE and VibB with compatible fluorophores.

      • Monitor real-time interaction during catalysis.

  • Mutation Studies:

    • Alanine scanning mutagenesis:

      • Systematically replace putative interface residues.

      • Measure effects on binding and catalytic transfer.

    • Complementary mutations:

      • Create pairs of mutations that rescue activity when combined.

      • Provides strong evidence for specific interactions.

  • Experimental Controls:

    • Negative controls:

      • Unrelated proteins of similar size and properties.

      • VibE/VibB variants with mutations in catalytic residues.

    • Positive controls:

      • Known interacting protein pairs with similar characteristics.

      • Chemical crosslinking to verify proximity.

This comprehensive approach combines multiple methodologies to build a robust understanding of VibE-VibB interactions.

What are the most effective approaches for troubleshooting VibE expression and purification issues?

Troubleshooting VibE expression and purification requires systematic approaches:

IssuePotential CausesSolutionsVerification Method
Poor solubilityIncorrect folding, hydrophobic regionsLower induction temperature (16-20°C), reduce IPTG (0.1-0.2 mM), use solubility tags (SUMO, MBP)SDS-PAGE of soluble vs. insoluble fractions
Low expressionRare codons, toxicity, mRNA instabilityCodon optimization, tRNA-supplemented strains, controlled expression systemsRT-qPCR for transcription, Western blot for protein
Protein instabilityProteolysis, aggregation, oxidationAdd protease inhibitors, include reducing agents, optimize bufferTime-course stability studies, thermal shift assays
Loss of activityDenaturation, cofactor lossGentle purification, inclusion of cofactorsActivity assays at each purification step
Non-specific bindingExposed hydrophobic patchesAdd low detergent (0.05% Triton X-100), increase salt in wash buffersSDS-PAGE analysis of wash and elution fractions

A systematic optimization approach should:

  • Start with expression screening of multiple constructs and conditions

  • Perform small-scale purification trials before scaling up

  • Implement activity assays at each step

  • Consider structural information to design stable constructs

Successful optimization typically yields >90% protein in the soluble fraction, a single band on SDS-PAGE after final purification, and consistent specific activity between batches.

How can researchers address specificity challenges in VibE activity assays?

Addressing specificity challenges in VibE activity assays requires careful experimental design:

  • Substrate Purity Verification:

    • HPLC or LC-MS analysis of commercial 2,3-DHB to confirm absence of isomers.

    • NMR characterization to verify structure.

    • Use of freshly prepared solutions to avoid oxidation products.

  • Assay Method Selection:

    • Direct product detection methods (LC-MS, HPLC) provide higher specificity than coupled assays.

    • ATP-[³²P]PPi exchange assays offer high sensitivity and specificity for adenylation reaction.

    • For coupled assays, validate that coupling enzymes are not rate-limiting.

  • Specificity Controls:

    • Include negative controls (no enzyme, heat-inactivated enzyme).

    • Test structural analogs (2,5-DHB, 3,4-DHB, salicylic acid) to quantify specificity.

    • Compare activity with related adenylation enzymes (e.g., EntE from E. coli).

  • Optimization Parameters:

    • Determine optimal pH, temperature, and buffer composition.

    • Establish linear range for enzyme concentration and reaction time.

    • Validate metal ion requirements and optimal concentrations.

  • Data Analysis Considerations:

    • Calculate specificity constants (kcat/Km) to properly assess substrate preference.

    • Use appropriate enzyme kinetics models for data fitting.

    • Perform statistical analysis to distinguish significant differences.

A comprehensive substrate specificity analysis should include testing VibE activity with multiple structurally related compounds and determining complete kinetic parameters for those showing significant activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.