Recombinant Vibrio fischeri ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal results, we recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; VF_2570; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Vibrio fischeri (strain ATCC 700601 / ES114)
Target Names
atpB
Target Protein Sequence
MAAPGEALTQSGYIEHHLTNLSLAKLGLVADEASFWNVHIDSLFFSVFTGMLFLWVFRSV AKKATTGVPGKLQCFVEMIVEFVADNVKETFHGRNPLIAPLALTIFCWVILMNLMDLVPI DFLPYPAEHWLGIPYLKVVPSADVNITMAMALGVFALMIYYSIKVKGLGGFAKELALHPF NHPIMIPFNLLLEVISLLAKPLSLGMRLFGNMFAGEVVFILIAAMLPWYLQWVGALPWAI FHILVILIQAFVFMMLTIVYLSMAHEDSDH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Database Links

KEGG: vfi:VF_2570

STRING: 312309.VF_2570

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of atpB in Vibrio fischeri?

ATP synthase subunit a (atpB) in Vibrio fischeri plays a crucial role in energy metabolism as part of the F0F1-ATP synthase complex. This membrane-embedded subunit forms part of the proton channel in the F0 sector and is directly involved in converting the proton motive force into mechanical energy that drives ATP synthesis.

In Vibrio fischeri, this energy production is particularly important during symbiotic colonization of the squid Euprymna scolopes, where the bacterium must maintain energy homeostasis in changing environmental conditions. While less is directly known about atpB specifically, studies of Vibrio fischeri's symbiotic relationship demonstrate the importance of proper energy metabolism for successful colonization .

What expression systems are most effective for recombinant production of Vibrio fischeri atpB?

E. coli is the predominant expression system for recombinant Vibrio fischeri atpB production. The protein can be successfully expressed with an N-terminal His tag, which facilitates purification while maintaining functional properties. When expressing this membrane protein, key considerations include:

  • Using E. coli strains optimized for membrane protein expression (e.g., C41(DE3), C43(DE3))

  • Lowering induction temperature (16-25°C) to reduce inclusion body formation

  • Utilizing mild detergents during extraction to maintain protein structure

  • Employing controlled expression systems to prevent toxicity to host cells

The addition of the His tag at the N-terminus has been demonstrated to be effective for subsequent purification without compromising protein functionality .

What are the recommended storage conditions for purified recombinant atpB?

Purified recombinant Vibrio fischeri atpB should be stored according to these guidelines to maintain stability and activity:

  • Store at -20°C/-80°C upon receipt

  • Aliquot the protein to avoid repeated freeze-thaw cycles

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended)

  • For working solutions, store aliquots at 4°C for up to one week

The protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability during storage. Repeated freeze-thaw cycles significantly reduce protein activity and should be avoided .

How can recombinant atpB be used to study ATP synthase assembly and function?

Recombinant Vibrio fischeri atpB can be utilized in several experimental approaches to investigate ATP synthase assembly and function:

  • Reconstitution experiments: Purified atpB can be reconstituted into liposomes along with other ATP synthase subunits to study the assembly process and functional properties of the complex.

  • Site-directed mutagenesis: By creating specific mutations in the atpB sequence, researchers can identify critical residues involved in proton translocation or subunit interactions.

  • Protein-protein interaction studies: Techniques such as co-immunoprecipitation or crosslinking using the His-tagged atpB can help identify interaction partners within the ATP synthase complex.

  • Structural studies: The purified protein can be used for crystallization attempts or cryo-electron microscopy to determine the structure of Vibrio fischeri ATP synthase.

  • Functional assays: ATP synthesis/hydrolysis assays can be performed with reconstituted complexes containing the recombinant atpB to assess functionality.

These approaches provide insights into the molecular mechanisms of ATP synthesis in Vibrio fischeri and how this process may differ from other bacterial species .

What methods are recommended for assessing the purity and activity of recombinant atpB?

MethodPurposeProtocol Highlights
SDS-PAGEPurity assessmentRun protein samples on 12-15% gels; stain with Coomassie blue; expect >90% purity
Western blottingIdentity confirmationUse anti-His antibodies or specific anti-atpB antibodies; 270 aa protein should appear at ~30 kDa
Size exclusion chromatographyOligomeric state assessmentAnalyze protein behavior on Superdex 200 columns to determine if monomeric or part of complexes
Circular dichroismSecondary structure verificationMeasure from 190-260 nm to confirm alpha-helical content expected for membrane proteins
Reconstitution assaysFunctional assessmentIncorporate protein into liposomes with other ATP synthase subunits; measure proton translocation or ATP synthesis

For purity assessments, SDS-PAGE analysis should show a band at approximately 30 kDa with >90% purity. The protein can be verified through Western blotting using antibodies against the His tag or specific antibodies against atpB .

What are the key structural domains in Vibrio fischeri atpB and their functions?

Vibrio fischeri atpB contains several key structural domains that are critical for its function in the ATP synthase complex:

  • Transmembrane helices: The protein contains multiple hydrophobic regions that form transmembrane α-helices spanning the cell membrane. These helices create the proton channel essential for ATP synthesis.

  • Proton-binding sites: Specific residues within the transmembrane domains are involved in proton binding and translocation. These typically include conserved acidic residues (Asp, Glu) that can be protonated and deprotonated.

  • Interaction interfaces: The protein contains regions that interact with other subunits of the ATP synthase complex, particularly subunit c of the c-ring and the peripheral stalk.

  • N-terminal domain: The N-terminal region likely extends into the cytoplasm and may be involved in regulatory interactions.

Structural analysis reveals that atpB is predominantly α-helical, which is characteristic of membrane-embedded proteins. When expressing the recombinant protein with an N-terminal His tag, care must be taken to ensure the tag does not interfere with the critical transmembrane domains .

How does the structure of Vibrio fischeri atpB compare to homologous proteins in other bacterial species?

While detailed structural comparisons of Vibrio fischeri atpB with other bacterial homologs have not been extensively documented in the available literature, general principles can be inferred:

A comprehensive sequence alignment and structural modeling would be necessary to identify specific differences that might relate to Vibrio fischeri's unique ecological niche and symbiotic relationships .

How does atpB contribute to Vibrio fischeri's symbiotic relationship with the squid Euprymna scolopes?

While the available search results don't directly address atpB's specific role in symbiosis, we can infer its importance based on general principles of bacterial energetics and the known requirements for successful colonization:

  • Energy production for colonization: Vibrio fischeri requires sufficient ATP to power flagellar motility, which is essential for initial colonization of the squid light organ. As a critical component of ATP synthase, atpB would be indispensable for this energy generation.

  • Adaptation to changing environments: During the transition from seawater to the squid light organ, V. fischeri encounters changing oxygen levels and nutrient availability. ATP synthase function, dependent on atpB, would be crucial for adapting to these metabolic shifts.

  • Bioluminescence support: The light-producing capability of V. fischeri, which is central to its symbiotic relationship, requires significant energy input. ATP synthase would provide the necessary energy for this metabolically demanding process.

  • Biofilm formation: While not directly related to atpB, other V. fischeri proteins like AmiB have been shown to influence biofilm formation, which is important for colonization. Proper energy metabolism supported by ATP synthase would be required for these colonization processes .

What is known about the regulation of atpB expression in Vibrio fischeri under different environmental conditions?

  • Oxygen-dependent regulation: V. fischeri transitions between aerobic and microaerobic environments during colonization, likely influencing atpB expression to adapt ATP production to available electron acceptors.

  • Growth phase-dependent expression: ATP synthase genes are typically differentially regulated between exponential and stationary growth phases to match energy production with metabolic demands.

  • Quorum sensing influence: V. fischeri uses sophisticated quorum sensing systems, which might coordinate atpB expression with population density and colonization stage.

  • Host-derived signals: Chemical cues from the squid host potentially influence metabolic gene expression, including ATP synthase components.

Research specifically targeting atpB regulation in V. fischeri under symbiotic versus free-living conditions would be valuable for understanding the protein's role in the bacterium's adaptive capabilities .

What are common challenges when working with recombinant Vibrio fischeri atpB and how can they be addressed?

ChallengePotential CausesSolutions
Low expression yieldToxicity to host cells; Protein instabilityUse tightly controlled induction systems; Lower induction temperature (16-20°C); Add stabilizing agents (glycerol, trehalose)
Inclusion body formationOverexpression; Improper foldingReduce expression rate with lower IPTG concentrations; Co-express with chaperones; Use specialized E. coli strains (C41/C43)
Poor solubilizationInadequate detergent selectionTest multiple detergents (DDM, LDAO, Fos-choline); Optimize detergent concentration; Try extraction at different temperatures
Aggregation after purificationDetergent exchange issues; Protein instabilityMaintain critical micelle concentration of detergents; Add glycerol (5-10%); Avoid concentration above 5 mg/ml
Loss of activityDenaturation; Loss of lipid interactionsReconstitute in lipid nanodiscs or liposomes; Add E. coli lipid extract during purification

When working with membrane proteins like atpB, maintaining the proper membrane environment or mimicking it with appropriate detergents is crucial. For storage, adding 6% trehalose and maintaining proper pH (8.0) in Tris/PBS buffer has been shown to be effective .

How can researchers verify the functional integrity of purified recombinant atpB?

Verifying the functional integrity of purified recombinant Vibrio fischeri atpB requires several complementary approaches:

  • Secondary structure analysis: Circular dichroism spectroscopy can confirm the expected high α-helical content characteristic of properly folded atpB.

  • Thermal stability assays: Differential scanning fluorimetry or thermal shift assays can assess protein stability and the effects of different buffer conditions.

  • Binding assays: The ability of atpB to interact with other ATP synthase subunits (particularly c-subunits) can be assessed using pull-down assays or surface plasmon resonance.

  • Reconstitution studies: Incorporating atpB into liposomes along with other ATP synthase components and measuring proton translocation using pH-sensitive dyes.

  • ATP synthesis assays: The ultimate functional test involves reconstituting the complete ATP synthase complex with the recombinant atpB and measuring ATP production in response to a proton gradient.

  • Structural integrity: Limited proteolysis can be used to assess whether the protein maintains a compact, properly folded structure resistant to proteolytic digestion .

How can recombinant atpB be used to investigate the bioenergetics of Vibrio fischeri during host colonization?

Recombinant Vibrio fischeri atpB can serve as a valuable tool for investigating the bioenergetics of host colonization through several advanced research approaches:

  • In vitro reconstitution systems: Purified atpB can be incorporated into synthetic membrane systems along with other ATP synthase components to recreate and study energy production under conditions mimicking those in the squid light organ (varying oxygen levels, pH, salt concentrations).

  • Structure-function relationship studies: Site-directed mutagenesis of recombinant atpB can identify residues critical for function under symbiotic conditions. These mutated proteins can be tested in reconstituted systems and potentially in complementation studies with atpB knockout strains.

  • Antibody development: Purified recombinant atpB can be used to generate specific antibodies for immunolocalization studies, allowing researchers to track ATP synthase distribution and abundance during different stages of colonization.

  • Protein-protein interaction studies: His-tagged recombinant atpB can be used in pull-down assays to identify potential regulatory proteins that may interact with ATP synthase specifically during symbiotic conditions.

  • Comparative studies with free-living bacteria: The properties of atpB from V. fischeri can be compared to those from non-symbiotic bacteria to identify adaptations specific to the symbiotic lifestyle .

What are promising directions for future research on Vibrio fischeri atpB and ATP synthase?

Several promising research directions for Vibrio fischeri atpB and ATP synthase warrant further investigation:

  • Structural biology approaches: Determining the high-resolution structure of V. fischeri ATP synthase, with particular focus on the atpB subunit, would provide valuable insights into any unique adaptations for symbiotic life.

  • Systems biology integration: Investigating how ATP synthase activity coordinates with other energy-producing pathways during the transition from free-living to symbiotic states could reveal regulatory networks specific to V. fischeri.

  • Comparative genomics and evolution: Analyzing atpB sequences across Vibrio species with different host associations could identify adaptive mutations related to specific symbiotic relationships.

  • Host-microbe energetic interactions: Exploring how host-derived factors influence ATP synthase activity and expression could reveal communication mechanisms between squid and bacteria.

  • Metabolic modeling: Developing computational models of V. fischeri energy metabolism that incorporate ATP synthase function could predict energetic requirements for different stages of colonization.

  • CRISPR-based studies: Using precise genetic modifications of atpB in vivo could help determine its importance in colonization efficiency, persistence, and bioluminescence production.

Future research integrating these approaches would substantially advance our understanding of how energy metabolism, mediated by ATP synthase, contributes to the establishment and maintenance of this model symbiotic relationship .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.