Recombinant Vibrio fischeri Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Functional Mechanism

DsbB reoxidizes reduced DsbA via a quinone-dependent pathway, enabling de novo disulfide bond formation. Key steps include:

  1. Electron Transfer: DsbB reduces quinones (e.g., ubiquinone) in the membrane, transferring electrons from the cytoplasm to the periplasm.

  2. Disulfide Exchange: The oxidized DsbB transfers disulfides to reduced DsbA, regenerating its active form. This process involves two cysteine pairs:

    • Cys-41/Cys-44: Proximal to quinone-binding sites.

    • Cys-104/Cys-130: Interacts with DsbA for disulfide exchange .

Recombinant Protein Production

Recombinant Vibrio fischeri DsbB is expressed in E. coli as a His-tagged protein for structural and functional studies. Key specifications include:

ParameterValueSource
Purity>90% (SDS-PAGE)
Storage BufferTris-based buffer, 50% glycerol, pH 8.0
StabilityLyophilized powder; store at -20°C/-80°C to avoid degradation

Comparative Functional Studies

While Vibrio fischeri DsbB shares structural homology with E. coli DsbB, key differences include:

  • Redox Potential: E. coli DsbB’s disulfides have lower redox potentials (-271 mV and -284 mV) compared to DsbA (-120 mV), enabling efficient electron transfer .

  • Mutational Resistance: In E. coli, mutations in DsbB (e.g., L25P, K39E) confer resistance to pyridazinone inhibitors, suggesting conserved resistance mechanisms across species .

Role in Pathogenicity and Antimicrobial Targeting

DsbB is essential for virulence in Gram-negative pathogens, as disulfide bonds stabilize toxins, adhesins, and efflux pumps. Inhibitors targeting DsbB (e.g., pyridazinones) disrupt disulfide bond formation, reducing bacterial survival . For Vibrio fischeri, DsbB likely supports bioluminescence-related proteins, though direct evidence remains limited.

Challenges and Future Directions

  • Structural Mobility: The Cys-104/Cys-130 loop exhibits conformational flexibility, complicating inhibitor design .

  • Species-Specific Studies: Limited experimental data exist for Vibrio fischeri DsbB; further research is needed to validate its role in symbiosis or pathogenesis.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference point for your own protocols.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us and we will prioritize developing it accordingly.
Synonyms
dsbB; VF_1635; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Vibrio fischeri (strain ATCC 700601 / ES114)
Target Names
dsbB
Target Protein Sequence
MQALNHFSRIRLSWFLLLLCIIFFEASALTFQHIMKLPPCVMCIYERVAMMGIGGAAIIG LLNPNNLIIRWCGFIAWGISAGWGLKLALEHVDFQLNPSPFSTCDLFVTFPSWAPLNKWA PWMFEAYGDCSKIVWQFLTLTMPQWLVIIFAGNLIALAIFVIAQFFNKK
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links

KEGG: vfi:VF_1635

STRING: 312309.VF_1635

Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of DsbB in Vibrio fischeri?

DsbB in Vibrio fischeri functions as an integral membrane protein that mediates disulfide bond formation in periplasmic proteins. Similar to the well-characterized DsbB in E. coli, V. fischeri DsbB works in concert with the soluble periplasmic protein DsbA to form a disulfide bond formation pathway. DsbB reoxidizes DsbA after it catalyzes disulfide bond formation in substrate proteins, and DsbB itself is re-oxidized by transferring reducing equivalents to ubiquinone or menaquinone in the membrane . This oxidative pathway is critical for proper protein folding in the periplasm and contributes to various cellular functions including motility, resistance to reducing agents, and potential virulence factors in related pathogenic species .

How is the structure of Vibrio fischeri DsbB organized?

Based on structural studies of homologous DsbB proteins, V. fischeri DsbB is predicted to be a membrane protein with four transmembrane helices arranged in a bundle with the N- and C-termini facing the cytoplasm. The protein contains two periplasmic loops with redox-active cysteine pairs, typically positioned similarly to the C41/C44 and C104/C130 pairs in E. coli DsbB . The first cysteine pair is located in proximity to the bound quinone cofactor, while the second pair functions as the site for disulfide exchange with DsbA. The structure enables coordinated electron flow from substrate proteins through DsbA to DsbB and ultimately to the quinone pool in the membrane .

What genetic tools are available for creating recombinant Vibrio fischeri DsbB constructs?

Several genetic manipulation tools are available for creating recombinant V. fischeri DsbB. Researchers can introduce linear DNA via transformation to make chromosomal mutations or modifications. The bacterium is naturally competent, allowing it to take up linear DNA from the environment which can then integrate into the genome via homologous recombination . Additionally, plasmid DNA can be introduced via conjugation. For marker-free mutations, the Flp-FRT system has been adapted for use in V. fischeri to eliminate antibiotic resistance cassettes that are flanked by FRT sites . Researchers can also use transposon mutagenesis for random or specific mutagenesis of V. fischeri genes including dsbB .

What is the most effective method for expressing recombinant V. fischeri DsbB in a heterologous system?

For heterologous expression of V. fischeri DsbB, a multi-step approach is recommended:

  • Vector selection: Use vectors with inducible promoters (like pBAD or pET) that allow tight control of expression for membrane proteins.

  • Host strain optimization: E. coli C41(DE3) or C43(DE3) strains are preferred as they are engineered for membrane protein expression with reduced toxicity.

  • Induction parameters:

    • Temperature: Lower temperatures (16-25°C) improve proper folding

    • Inducer concentration: Lower concentrations (0.1-0.5 mM IPTG or 0.002-0.02% arabinose) reduce aggregation

    • Duration: Extended expression periods (16-24 hours) at lower temperatures yield better results

  • Membrane fraction isolation: Use differential centrifugation with a series of buffers containing appropriate detergents (typically 1-2% n-dodecyl-β-D-maltoside) to extract DsbB from membranes.

  • Purification strategy: Employ immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography using buffers containing 0.02-0.05% detergent to maintain protein solubility .

For researchers working with V. fischeri directly, natural transformation provides an alternative approach for introducing modified dsbB constructs directly into the V. fischeri genome .

How can I assess the enzymatic activity of recombinant V. fischeri DsbB in vitro?

The enzymatic activity of recombinant V. fischeri DsbB can be assessed through several complementary approaches:

  • Quinone reduction assay: Monitor the reduction of ubiquinone by purified DsbB spectrophotometrically at 275 nm in the presence of reduced DsbA. The rate of quinone reduction correlates with DsbB activity.

  • DsbA reoxidation assay: Measure the rate at which DsbB reoxidizes reduced DsbA using Ellman's reagent (DTNB) to quantify free thiols over time.

  • Fluorescence-based assays: Use fluorescent probes sensitive to the redox state of DsbA to monitor real-time DsbA reoxidation by DsbB.

  • Coupled enzyme assays: The complete pathway can be reconstituted with reduced substrate proteins, DsbA, DsbB, and quinone, monitoring disulfide formation in the substrate protein.

The activity measurements should be performed under anaerobic conditions to prevent non-enzymatic oxidation, with careful control of temperature (typically 25-30°C) and pH (7.5-8.0) to match the periplasmic environment of V. fischeri .

What are the optimal conditions for studying DsbB-DsbA interactions in Vibrio fischeri?

To study DsbB-DsbA interactions in V. fischeri effectively:

  • Buffer composition: 50 mM Tris-HCl or sodium phosphate, pH 7.5-8.0, 150 mM NaCl, 0.02-0.05% n-dodecyl-β-D-maltoside or other mild detergents for DsbB solubilization.

  • Redox control: Include defined ratios of reduced/oxidized glutathione (typically 1:10 to 1:100) to maintain physiologically relevant redox potential.

  • Interaction studies:

    • Surface plasmon resonance (SPR) with immobilized DsbA or DsbB

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Pull-down assays using tagged proteins

    • Cross-linking approaches to capture transient interactions

  • Disulfide exchange monitoring: Use mass spectrometry to identify and quantify mixed disulfide intermediates between specific cysteine residues.

  • In vivo validation: Complementation assays in dsbA or dsbB mutant strains of V. fischeri to verify that interaction observations correlate with functional outcomes in living cells .

How does the electron transfer mechanism in V. fischeri DsbB differ from other Vibrio species?

The electron transfer mechanism in V. fischeri DsbB likely follows a similar pathway to that described in E. coli and other Vibrio species, but with species-specific adaptations. In E. coli, a coordinated pathway for electron flow has been established where electrons flow from substrates to DsbA, then to the C104/C130 pair in DsbB, followed by transfer to the C41/C44 pair, and finally to ubiquinone .

V. fischeri DsbB may exhibit unique characteristics due to its symbiotic lifestyle with the Hawaiian bobtail squid. Possible differences include:

  • Quinone specificity: V. fischeri may preferentially use different quinone types depending on its growth conditions within the light organ of the squid.

  • Redox potential optimization: The redox potential of the cysteine pairs might be tuned differently to function optimally in the microaerobic environment of the squid light organ.

  • Regulatory mechanisms: The expression and activity of DsbB in V. fischeri may be integrated with bioluminescence pathways, which are critical for the symbiotic relationship.

  • Interaction with host factors: The DsbB-DsbA system in V. fischeri might interact with host-derived redox molecules present in the squid light organ.

Experimental approaches to elucidate these differences would include comparative biochemical characterization of purified DsbB proteins from multiple Vibrio species, mutagenesis of key residues unique to V. fischeri DsbB, and in vivo studies examining disulfide bond formation under conditions that mimic the squid light organ environment .

What role does DsbB play in Vibrio fischeri colonization of the Hawaiian bobtail squid?

DsbB likely plays a crucial role in V. fischeri colonization of the Hawaiian bobtail squid through several mechanisms:

  • Motility support: DsbB mutants in related bacteria show impaired motility due to improper assembly of the flagellar motor . Since V. fischeri must swim through mucus-filled ducts to reach the light organ crypts, functional flagella are essential for colonization .

  • Stress resistance: The squid light organ environment contains antimicrobial factors, and the DsbB-DsbA system likely contributes to bacterial stress resistance by ensuring proper folding of periplasmic defense proteins.

  • Biofilm formation regulation: The disulfide bond formation pathway may influence the aggregation behavior of V. fischeri. Research in V. fischeri has shown that nucleases like Dns control cell-cell aggregation , and proper folding of such extracellular enzymes often depends on disulfide bonds formed via the DsbB-DsbA pathway.

  • Interaction with mucus: V. fischeri encounters DNA-containing mucin during colonization . Properly folded mucin-degrading enzymes, which may require disulfide bonds, could be essential for the bacterium to navigate through the mucus layer.

  • Bioluminescence regulation: The light-producing capability of V. fischeri, which is essential for the symbiotic relationship, depends on properly folded enzymes in the lux pathway, potentially requiring a functional disulfide bond formation system.

Experimental approaches to test these hypotheses would include creating dsbB mutants in V. fischeri, assessing their colonization efficiency, and examining specific phenotypes related to motility, stress resistance, and bioluminescence in the context of squid colonization .

How can site-directed mutagenesis of V. fischeri DsbB cysteine residues provide insight into its catalytic mechanism?

Site-directed mutagenesis of the cysteine residues in V. fischeri DsbB can reveal critical insights into its catalytic mechanism through the following experimental approaches:

  • Single and double cysteine mutants: Creating a panel of mutants (C→A or C→S) for each of the four conserved cysteines would help establish the essential nature of each residue and the sequential flow of electrons.

  • Mixed disulfide trapping: Introduction of strategic cysteine mutations can stabilize normally transient mixed disulfide intermediates between DsbB and DsbA, allowing for their isolation and characterization via crystallography or mass spectrometry.

  • Non-native disulfide engineering: Creating non-native disulfide bonds by introducing cysteine pairs at specific locations can test hypotheses about conformational changes during the catalytic cycle.

  • Quinone binding site mutations: Mutations in residues near the C41/C44 pair (using E. coli numbering as reference) can elucidate how quinone binding affects the redox properties of the adjacent cysteine pair.

  • Loop flexibility alterations: Modifications that alter the flexibility of the periplasmic loop containing the C104/C130 pair can reveal the importance of conformational dynamics in the interaction with DsbA.

The expected outcomes would include:

  • Identification of the rate-limiting step in the electron transfer pathway

  • Characterization of the quinone binding site geometry and specificity

  • Understanding how structural changes in DsbB correlate with different oxidation states during the catalytic cycle

These findings would not only advance understanding of V. fischeri DsbB specifically but also provide insights applicable to the broader family of disulfide bond formation proteins across bacterial species .

How does V. fischeri DsbB compare structurally and functionally to its homologs in pathogenic Vibrio species?

V. fischeri DsbB shares structural and functional similarities with homologs in pathogenic Vibrio species, but with notable differences that reflect their diverse ecological niches:

FeatureV. fischeri DsbBPathogenic Vibrio DsbB (e.g., V. cholerae)
Membrane topology4 transmembrane helices4 transmembrane helices
Active site cysteinesTwo conserved pairs (similar to C41/C44 and C104/C130 in E. coli)Two conserved pairs at equivalent positions
Quinone preferenceLikely adapts to microaerobic conditions in squid light organOptimized for various host environments
RegulationPotentially integrated with bioluminescence pathwaysLinked to virulence factor expression
Role in host interactionSupports symbiotic colonizationContributes to pathogenesis
Environmental adaptationsSpecialized for specific symbiotic nicheBroader adaptability to diverse host environments

Functional differences likely emerge from subtle variations in:

  • Redox potential of the cysteine pairs

  • Substrate specificity determinants

  • Regulatory mechanisms controlling expression

  • Interaction with host defense systems

Understanding these differences can provide insights into how the basic disulfide bond formation machinery has been adapted for either symbiotic or pathogenic lifestyles within the Vibrio genus .

What insights can recombinant V. fischeri DsbB provide for developing novel antimicrobial strategies?

Recombinant V. fischeri DsbB offers valuable insights for antimicrobial development through several avenues:

  • Comparative structural analysis: As a non-pathogenic relative of pathogenic Vibrio species, V. fischeri DsbB serves as an excellent model for studying the conserved features of DsbB across the genus. Structural studies can identify unique pockets or interaction surfaces that might be targeted by small molecule inhibitors .

  • Inhibitor screening platforms: Purified recombinant V. fischeri DsbB can be used in high-throughput screening assays to identify compounds that inhibit its activity. These compounds can then be tested against pathogenic species' DsbB proteins.

  • Mechanism-based drug design: Understanding the precise catalytic mechanism through mutagenesis studies of V. fischeri DsbB can inform rational design of mechanism-based inhibitors that might disrupt disulfide bond formation in pathogens.

  • Quinone binding site targeting: The quinone binding site in DsbB represents a unique target not present in eukaryotic disulfide formation systems. Compounds that compete with quinone binding could selectively inhibit bacterial disulfide bond formation .

  • Cross-species validation: V. fischeri provides a safe system for validating potential antimicrobial targets before testing in pathogenic species. Genetic manipulations in V. fischeri can help predict the consequences of DsbB inhibition in related pathogens.

This research direction is particularly promising because the structural distinction between prokaryotic and eukaryotic disulfide bond formation pathways offers the potential for selective targeting of bacterial systems, potentially leading to novel broad-spectrum antibiotics with reduced risk of side effects .

How can the natural transformation system of V. fischeri be optimized for efficient manipulation of the dsbB gene?

The natural transformation system of V. fischeri can be optimized for efficient dsbB manipulation through the following methodological improvements:

  • Optimized competence induction:

    • Grow V. fischeri to mid-logarithmic phase (OD600 of 0.25-0.4) in LBS medium

    • Transfer to chitin-containing medium or add chitin oligosaccharides to induce the competence pathway

    • Incubate at 24-28°C for 16-24 hours to maximize competence development

  • DNA design strategies:

    • Include at least 500-1000 bp homologous flanking sequences on each side of the desired dsbB modification

    • Optimize codon usage for V. fischeri if introducing novel sequences

    • Consider using antibiotic resistance cassettes flanked by FRT sites for subsequent marker removal

    • Design screening primers that span the modification site for easy verification

  • Transformation enhancement:

    • Use high-quality, freshly prepared DNA (1-5 μg per transformation)

    • Pre-treat cells with calcium chloride (50-100 mM) to enhance DNA uptake

    • Optimize the recovery period (3-6 hours) at 28°C in rich medium before selective plating

    • Consider multiple rounds of plating if transformation efficiency is low

  • Selection and verification protocols:

    • Use appropriate antibiotic concentrations optimized for V. fischeri

    • Implement a two-step verification process: antibiotic resistance followed by PCR confirmation

    • Sequence the entire modified region to ensure no unintended mutations occurred

    • Confirm phenotypic effects through appropriate functional assays

  • Advanced applications:

    • For marker-free mutations, introduce the Flp recombinase on a temperature-sensitive plasmid

    • For multiple mutations, perform sequential transformations with alternating markers

    • Consider CRISPR-Cas9 systems adapted for V. fischeri to enhance specificity of modifications

This optimized protocol significantly improves transformation efficiency for dsbB modifications, enabling more sophisticated genetic manipulations in V. fischeri for studies of disulfide bond formation .

What are the common challenges in purifying active recombinant V. fischeri DsbB and how can they be addressed?

Purifying active recombinant V. fischeri DsbB presents several challenges due to its membrane protein nature. Here are common issues and their solutions:

Additional troubleshooting tips:

  • Monitor disulfide bond status throughout purification using non-reducing SDS-PAGE

  • Validate proper folding through limited proteolysis patterns

  • Consider co-expression with DsbA to stabilize native conformation

  • Use fluorescence-detection size-exclusion chromatography (FSEC) to assess protein quality before full-scale purification

These strategies significantly improve the chances of obtaining homogeneous, properly folded, and catalytically active V. fischeri DsbB protein suitable for biochemical and structural studies .

How can researchers address the challenge of studying membrane protein interactions between DsbB and DsbA in V. fischeri?

Studying membrane protein interactions between DsbB and DsbA in V. fischeri requires specialized approaches to overcome inherent technical challenges:

  • Detergent selection and optimization:

    • Systematic screening of detergents using thermal stability assays

    • Use of mild detergents like DDM, LMNG, or digitonin that preserve protein-protein interactions

    • Consider nanodiscs or lipid bicelles as alternative membrane mimetics that better preserve the native environment

  • Stabilizing the transient interaction:

    • Generate DsbB variants with cysteine-to-alanine mutations to trap mixed disulfide intermediates

    • Use chemical crosslinking with bifunctional reagents of varying spacer lengths

    • Consider genetically encoded photocrosslinking with unnatural amino acids at the interface

  • Direct biophysical approaches:

    • Microscale thermophoresis (MST) for measuring interactions in solution with minimal protein consumption

    • Biolayer interferometry (BLI) with careful optimization of immobilization strategies

    • Native mass spectrometry with detergent screening to maintain complex integrity

  • In situ approaches:

    • Förster resonance energy transfer (FRET) using fluorescently labeled proteins

    • Split GFP or luciferase complementation assays to detect interactions in living cells

    • Proximity labeling approaches (BioID or APEX) to map interaction surfaces

  • Computational methods:

    • Molecular dynamics simulations in explicit membrane environments

    • Protein-protein docking guided by experimental constraints

    • Coevolutionary analysis to identify potentially interacting residues

By combining multiple complementary approaches, researchers can overcome the limitations of individual methods and develop a comprehensive model of the DsbB-DsbA interaction in V. fischeri. This model can then inform the design of targeted experiments to test specific aspects of the interaction mechanism .

What are the critical controls needed when assessing the impact of dsbB mutations on V. fischeri-squid symbiosis?

When assessing the impact of dsbB mutations on V. fischeri-squid symbiosis, the following critical controls should be implemented:

  • Genetic controls:

    • Wild-type V. fischeri strain (positive control)

    • Complemented mutant (dsbB mutant with wild-type dsbB expressed in trans)

    • Vector-only control for complementation

    • Unrelated but similarly constructed mutant (to control for general mutagenesis effects)

    • Site-directed mutations affecting only specific functions of DsbB

  • Phenotypic characterization controls:

    • Growth curve analysis in multiple media conditions to rule out general growth defects

    • Motility assays to distinguish between colonization defects due to motility versus other functions

    • Expression level verification of DsbB in mutant and complemented strains

    • Assessment of disulfide bond formation in multiple periplasmic proteins

    • Verification of other symbiosis determinants (e.g., luminescence capability)

  • Colonization experiment controls:

    • Competitive colonization assays (mutant vs. wild-type at 1:1 ratio)

    • Single-strain colonization with standardized inoculum concentrations

    • Time course experiments to distinguish between initial colonization versus persistence defects

    • Microscopic examination of bacterial localization within the light organ

    • Assessment of squid immune response to mutant versus wild-type bacteria

  • Environmental variation controls:

    • Testing at different temperatures to assess temperature-dependent phenotypes

    • Varying salt concentrations to mimic different marine conditions

    • Evaluating colonization under different light cycles

  • Alternative host controls:

    • Testing colonization in different squid species if available

    • In vitro simulation of host conditions using squid-derived tissues or secretions

How might high-throughput approaches advance our understanding of V. fischeri DsbB substrate specificity?

High-throughput approaches offer powerful ways to comprehensively map V. fischeri DsbB substrate specificity and advance our understanding of disulfide bond formation in this symbiotic bacterium:

  • Proteomic identification of disulfide-bonded proteins:

    • Diagonal 2D gel electrophoresis comparing wild-type and dsbB mutant V. fischeri

    • Mass spectrometry-based identification of proteins with altered disulfide status

    • Quantitative proteomics to measure changes in protein abundance and modification state

    • Redox proteomics using isotope-coded affinity tags (ICAT) to quantify thiol modification states

  • Global genetic interaction screens:

    • Synthetic genetic array (SGA) analysis with dsbB mutations

    • Transposon insertion sequencing (Tn-Seq) in wild-type versus dsbB mutant backgrounds

    • CRISPR interference (CRISPRi) screens to identify genes with synthetic interactions with dsbB

  • High-throughput phenotypic assays:

    • Phenotype microarrays testing growth under hundreds of conditions

    • Automated microscopy to assess motility, morphology, and aggregation behaviors

    • Bioluminescence screening under varying conditions to link DsbB to light production

  • Structural and computational approaches:

    • Machine learning algorithms to predict DsbB-dependent substrates based on sequence and structural features

    • Molecular docking of the V. fischeri periplasmic proteome against DsbB and DsbA

    • AlphaFold2 or RoseTTAFold prediction of substrate protein structures with and without disulfide bonds

  • Direct biochemical screening:

    • Protein microarrays containing V. fischeri periplasmic proteins to identify direct DsbA substrates

    • In vitro translation systems coupled with disulfide formation assays

    • Fluorescence-based assays to measure real-time disulfide formation in candidate substrates

These high-throughput approaches would generate comprehensive data sets revealing the scope and specificity of the V. fischeri disulfide bond formation machinery. The resulting substrate profiles could then be compared with those of pathogenic Vibrio species to identify common core substrates versus specialist substrates that might reflect adaptation to symbiotic versus pathogenic lifestyles .

What potential applications exist for engineered variants of V. fischeri DsbB in biotechnology?

Engineered variants of V. fischeri DsbB offer several innovative applications in biotechnology:

  • Enhanced recombinant protein production:

    • Co-expression systems incorporating optimized V. fischeri DsbB/DsbA for improved disulfide bond formation in industrial protein production

    • Customized DsbB variants with altered substrate specificity for difficult-to-express proteins

    • Chimeric DsbB proteins combining domains from multiple species to enhance performance in specific expression systems

  • Biosensor development:

    • DsbB-based redox sensors to monitor oxidative environments

    • FRET-based sensors incorporating DsbB for detection of quinone-targeting antibiotics

    • Engineered bacterial reporters using DsbB-dependent pathways to detect contaminants in marine environments

  • Synthetic biology applications:

    • Integrating DsbB into synthetic circuits that respond to redox conditions

    • Creating artificial symbiosis systems based on V. fischeri's molecular machinery

    • Engineering bacteria with controllable biofilm formation regulated by modified DsbB systems

  • Enzyme stabilization technology:

    • Novel disulfide bonds in industrial enzymes designed based on V. fischeri DsbB substrate preferences

    • Extremophile-inspired DsbB variants that function under harsh industrial conditions

    • Immobilized DsbB systems for continuous in vitro disulfide bond formation

  • Drug discovery platforms:

    • High-throughput screening systems for DsbB inhibitors targeting pathogenic bacteria

    • Structure-based drug design using V. fischeri DsbB as a non-pathogenic model

    • Assay systems for compounds that selectively modulate disulfide bond formation

These biotechnological applications leverage the unique properties of V. fischeri DsbB, particularly its evolution in a symbiotic context, which may provide advantages in terms of stability, specificity, or functionality compared to homologs from other bacterial species .

How might systems biology approaches integrate DsbB function with other cellular processes in V. fischeri?

Systems biology approaches can provide a comprehensive understanding of how DsbB function integrates with other cellular processes in V. fischeri:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, metabolomics, and fluxomics data from wild-type and dsbB mutant strains

    • Develop network models that place DsbB in the context of cellular redox homeostasis

    • Identify metabolic adaptations that compensate for DsbB dysfunction

    • Map the impact of environmental perturbations on the integrated network

  • Regulatory network mapping:

    • ChIP-seq and RNA-seq to identify transcriptional regulators affected by DsbB function

    • Ribosome profiling to assess translational regulation in response to disulfide stress

    • Small RNA profiling to identify post-transcriptional regulatory mechanisms

    • Protein-protein interaction mapping using proximity labeling approaches

  • Spatiotemporal dynamics:

    • Live-cell imaging with fluorescent reporters to track DsbB activity during colonization

    • Single-cell analysis to identify heterogeneity in disulfide bond formation

    • Microfluidic approaches to simulate the changing environment during host colonization

    • 4D tracking of protein localization and interaction changes during symbiosis establishment

  • Multi-species modeling:

    • Host-microbe interaction models incorporating both squid and bacterial processes

    • Agent-based modeling of bacterial aggregation and colonization dynamics

    • Metabolic modeling of nutrient exchange between host and symbiont

    • Evolutionary game theory approaches to understand the stability of the symbiotic relationship

  • Predictive modeling:

    • Machine learning algorithms to predict cellular states based on DsbB activity levels

    • Constraint-based modeling to identify essential reactions connected to disulfide bond formation

    • Development of whole-cell models incorporating the disulfide bond formation pathway

    • In silico prediction of synthetic lethality and genetic interaction networks

These systems biology approaches would reveal how DsbB function is integrated with various cellular processes including bioluminescence, motility, stress response, and metabolism. This holistic understanding would provide insights into how V. fischeri has adapted its disulfide bond formation machinery to support its symbiotic lifestyle with the Hawaiian bobtail squid .

How can cryo-electron microscopy advance our structural understanding of V. fischeri DsbB?

Cryo-electron microscopy (cryo-EM) offers transformative potential for advancing our structural understanding of V. fischeri DsbB through several key approaches:

  • Single-particle analysis:

    • Visualization of DsbB alone and in complex with DsbA at near-atomic resolution

    • Capture of different conformational states during the catalytic cycle

    • Structural determination without the need for crystallization, overcoming a major hurdle for membrane proteins

    • Visualization of DsbB in nanodiscs or other membrane mimetics that better preserve native conformation

  • Tomography approaches:

    • Cellular tomography of V. fischeri cells to visualize DsbB distribution in the membrane

    • Subtomogram averaging to obtain medium-resolution structures in situ

    • Correlative light and electron microscopy to link DsbB localization with cellular function

    • Visualization of DsbB distribution during different stages of squid colonization

  • Technical advantages for challenging aspects:

    • Sample preparation using the Spotiton or chameleon systems for more consistent vitrification

    • Phase plate technology to enhance contrast of the relatively small DsbB protein (~21 kDa)

    • Direct electron detectors with improved signal-to-noise ratio for better resolution

    • Advanced computational algorithms to classify heterogeneous conformations

  • Time-resolved studies:

    • Time-resolved cryo-EM using microfluidic mixing to capture transient intermediates

    • Visualizing conformational changes upon binding of DsbA or quinone

    • Mapping the structural basis for electron transfer between redox centers

  • Integrative structural biology:

    • Combination with mass spectrometry to identify crosslinked regions

    • Validation with molecular dynamics simulations

    • Integration with functional data from mutagenesis studies

    • Comparative analysis with homologous proteins to identify conserved structural features

These approaches would overcome limitations of traditional X-ray crystallography for membrane proteins like DsbB, potentially revealing dynamic aspects of its function that have remained elusive. The resulting structures would provide a solid foundation for understanding the molecular mechanism of disulfide bond formation and for structure-based drug design targeting pathogenic Vibrio species .

What techniques can be used to monitor DsbB activity in live V. fischeri cells during squid colonization?

Monitoring DsbB activity in live V. fischeri cells during squid colonization requires sophisticated techniques that bridge molecular and microscopic approaches:

  • Genetically encoded redox sensors:

    • roGFP2-based sensors targeted to the periplasm to monitor redox environment

    • Split-fluorescent protein systems that report on DsbB-DsbA interactions

    • Disulfide bond-dependent luciferase reporters that emit light upon successful oxidation

    • FRET-based sensors that change conformation upon disulfide formation

  • Advanced microscopy techniques:

    • Light sheet microscopy for deep tissue imaging of transparent juvenile squid

    • Two-photon microscopy for better tissue penetration and reduced photobleaching

    • Super-resolution microscopy (STED, PALM, STORM) to visualize subcellular localization

    • Confocal intravital microscopy with miniaturized objectives for real-time imaging

  • Molecular probes and indicators:

    • Thiol-reactive fluorescent dyes to assess the redox state of periplasmic proteins

    • Click chemistry-compatible alkyne or azide tags on DsbB substrates

    • Quinone-specific fluorescent probes to monitor the redox state of the electron acceptor

    • Immunofluorescence with disulfide-specific antibodies in fixed samples

  • Multi-parameter monitoring:

    • Simultaneous tracking of DsbB activity, bacterial luminescence, and motility

    • Correlation of redox state with stages of colonization

    • Integration with microelectrode measurements of oxygen concentration

    • Parallel monitoring of host immune responses and bacterial activity

  • Microfluidic and ex vivo approaches:

    • Microfluidic devices replicating the squid light organ environment

    • Ex vivo culture of squid tissue with live imaging capabilities

    • Defined gradients of host factors to assess their impact on DsbB activity

    • Real-time monitoring of bacterial gene expression with activity reporters

These techniques would provide unprecedented insights into how DsbB function correlates with successful colonization, potentially revealing how disulfide bond formation is regulated during different stages of the symbiotic relationship and how it contributes to bacterial adaptation to the host environment .

How can computational approaches enhance our understanding of the evolution of DsbB in the Vibrio genus?

Computational approaches offer powerful tools for understanding the evolution of DsbB in the Vibrio genus:

  • Phylogenetic analysis:

    • Maximum likelihood and Bayesian phylogenetic reconstruction of DsbB across Vibrio species

    • Reconciliation of DsbB gene trees with species trees to identify horizontal gene transfer events

    • Ancestral sequence reconstruction to infer the properties of ancient DsbB proteins

    • Phylogenetic comparative methods to correlate DsbB sequence features with ecological niches

  • Molecular evolution analysis:

    • Detection of positive selection using dN/dS ratio analyses at codon resolution

    • Identification of coevolving residues within DsbB using mutual information analyses

    • Branch-site tests to identify episodic selection in specific Vibrio lineages

    • Relaxed clock models to estimate divergence times of DsbB variants

  • Structural bioinformatics:

    • Homology modeling of DsbB across the Vibrio genus

    • AlphaFold2 prediction of DsbB structures from diverse Vibrio species

    • Comparison of predicted binding sites for DsbA and quinone across species

    • Normal mode analysis to identify conserved dynamic properties

  • Network approaches:

    • Reconstruction of disulfide bond formation pathways across Vibrio species

    • Identification of species-specific substrates through comparative genomics

    • Analysis of genome context conservation to identify functionally linked genes

    • Metabolic network analysis to understand the integration of disulfide bond formation with cellular metabolism

  • Machine learning applications:

    • Classification of DsbB sequences by lifestyle (symbiotic vs. pathogenic)

    • Prediction of substrate specificity based on sequence features

    • Identification of functional residues through feature importance analysis

    • Deep learning approaches to identify subtle patterns in sequence-structure-function relationships

These computational approaches would reveal how DsbB has evolved across the Vibrio genus to support diverse lifestyles, from the symbiotic relationship of V. fischeri with the Hawaiian bobtail squid to the pathogenic interactions of species like V. cholerae with their hosts. The analysis would identify conserved features essential to DsbB function as well as adaptive changes that reflect specialization for particular ecological niches .

What are the key considerations for designing a research project focused on V. fischeri DsbB?

Designing a successful research project focused on V. fischeri DsbB requires careful consideration of multiple factors:

  • Experimental system selection:

    • Recombinant expression: Determine whether to work with native V. fischeri or heterologous expression in E. coli

    • In vivo vs. in vitro: Balance between physiological relevance and experimental control

    • Model complexity: Choose between purified components, membrane preparations, whole cells, or host-microbe systems

  • Technical capabilities assessment:

    • Protein biochemistry infrastructure for membrane protein purification

    • Molecular biology tools for genetic manipulation of V. fischeri

    • Microscopy capabilities for cellular localization studies

    • Biophysical instrumentation for interaction and structural studies

    • Access to squid colonization models if studying symbiosis aspects

  • Research question formulation:

    • Clearly define whether the focus is on basic biochemical mechanism, structural biology, physiological role, or symbiosis contribution

    • Develop testable hypotheses with appropriate controls

    • Ensure questions are tractable with available resources and techniques

    • Consider potential impact within the field and broader scientific community

  • Methodological considerations:

    • Start with validated protocols for V. fischeri genetic manipulation

    • Develop robust assays for DsbB activity and disulfide bond formation

    • Implement appropriate controls for membrane protein studies

    • Consider complementary approaches to address research questions

  • Collaboration planning:

    • Identify potential collaborators with specialized expertise or resources

    • Establish clear expectations for collaborative projects

    • Consider interdisciplinary approaches combining molecular biology, biochemistry, structural biology, and ecology

  • Anticipated challenges:

    • Difficulty of membrane protein expression and purification

    • Complexity of studying proteins within host-microbe interactions

    • Technical challenges of maintaining squid-Vibrio symbiosis in laboratory settings

    • Need for specialized equipment for certain analyses

By addressing these considerations proactively, researchers can design robust and impactful studies of V. fischeri DsbB that advance our understanding of disulfide bond formation in the context of bacterial symbiosis .

What ethical considerations apply to research on recombinant V. fischeri DsbB?

Research on recombinant V. fischeri DsbB involves several ethical considerations that responsible scientists should address:

  • Biosafety and biosecurity:

    • While V. fischeri is non-pathogenic , recombinant strains require appropriate containment

    • Genetic modifications should be carefully designed to avoid creating potentially harmful organisms

    • Follow institutional biosafety committee guidelines for proper handling and disposal

    • Consider dual-use implications if findings could potentially be applied to pathogenic Vibrio species

  • Animal welfare in symbiosis studies:

    • Implement the 3Rs (Replacement, Reduction, Refinement) when using Hawaiian bobtail squid

    • Obtain proper permits for collection and maintenance of marine organisms

    • Develop humane endpoints for experiments involving animals

    • Consider alternative models or ex vivo systems when possible

  • Environmental considerations:

    • Prevent release of genetically modified V. fischeri into natural environments

    • Design experiments to minimize environmental impact during field collections

    • Consider sustainable sourcing of organisms for laboratory studies

    • Properly dispose of all biological materials according to regulations

  • Research integrity:

    • Maintain accurate laboratory records and data management practices

    • Transparently report negative results alongside positive findings

    • Acknowledge limitations of experimental approaches

    • Share materials, protocols, and data according to FAIR principles (Findable, Accessible, Interoperable, Reusable)

  • Collaborative ethics:

    • Establish clear agreements regarding intellectual property and authorship

    • Respect traditional knowledge when working with organisms of cultural significance

    • Engage with local communities when conducting field research

    • Consider broader societal implications of antimicrobial research

By proactively addressing these ethical considerations, researchers can ensure that studies on V. fischeri DsbB contribute positively to scientific knowledge while minimizing potential risks and respecting the welfare of organisms and ecosystems involved in the research .

What are the most promising future directions for integrating V. fischeri DsbB research with broader bacterial symbiosis studies?

The integration of V. fischeri DsbB research with broader bacterial symbiosis studies offers several promising future directions:

  • Comparative symbiosis systems biology:

    • Parallel analysis of disulfide bond formation machinery across multiple symbiotic systems

    • Identification of convergent adaptations in disulfide bond formation across diverse host-microbe partnerships

    • Development of unified models for how redox homeostasis contributes to symbiotic relationships

    • Multi-omics comparison of DsbB function across symbiotic and non-symbiotic Vibrio species

  • Host-microbe interface exploration:

    • Investigation of how host-derived factors influence DsbB activity and regulation

    • Examination of disulfide-dependent secreted bacterial factors that mediate host communication

    • Characterization of how the squid immune system recognizes properly folded V. fischeri proteins

    • Analysis of how diurnal cycles in the light organ affect disulfide bond formation requirements

  • Microbial community context:

    • Study of how DsbB function influences interactions between V. fischeri and other microorganisms

    • Examination of horizontal gene transfer of disulfide-dependent systems within microbial communities

    • Investigation of how properly folded surface proteins affect competitive colonization dynamics

    • Exploration of how biofilm formation, influenced by disulfide-dependent processes , affects community structure

  • Evolutionary developmental biology integration:

    • Analysis of how DsbB-dependent processes co-evolved with host developmental programs

    • Investigation of how disulfide bond formation contributes to developmental specificity in symbiosis

    • Comparison of DsbB function in juvenile versus mature host associations

    • Exploration of how disulfide-dependent processes contribute to symbiosis establishment versus maintenance

  • Translational applications:

    • Development of probiotics with enhanced colonization capabilities through optimized disulfide bond formation

    • Engineering of beneficial symbioses for agricultural or environmental applications

    • Design of biomimetic systems based on principles derived from the V. fischeri-squid symbiosis

    • Application of findings to manage dysbiotic relationships in human or animal health

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.