Recombinant Vibrio fischeri Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Primary Structure

  • Amino Acid Sequence: Comprises 227 residues (1-227aa) with the sequence:
    MASHKELIKNGLWDNNPALVQLLGLCPLLAVSATVTNALGLGIATILVLVGSNLIVSLVRQWIPQEVRIPVFVMIIASLVTCVQLLMNAYAYGLYLSLGIFIPLIVTNCIIIGRAESFASKNDPLPAVLDGLWMGMGMTAVLVLLGAMREILGNGTLFDGADLLLGDWATILRIELFHVDSHFLLAMLPPGAFLGVGFLIALKNVIDKKMADRQPKEKAEIERVRIS .

  • Gene Information: Encoded by the gene VFMJ11_0969 (synonyms: rnfE, Ion-translocating oxidoreductase complex subunit E) .

  • UniProt ID: B5FCN0 .

Production and Purification

PropertySpecification
Expression HostEscherichia coli
TagN-terminal His tag
Purity>90% (SDS-PAGE)
FormLyophilized powder or liquid (Tris/PBS-based buffer with 6% trehalose)
Storage-20°C/-80°C (long-term); 4°C (short-term working aliquots)
ReconstitutionDeionized water (0.1–1.0 mg/mL), with glycerol for stability

Electron Transport and Energy Conservation

  • The Rnf complex (including RnfE) couples electron transfer from reduced ferredoxin to NAD+, generating a sodium ion gradient across the membrane .

  • In V. fischeri, RnfE is essential for competence development under conditions of TfoX overexpression, facilitating DNA uptake via redox-driven energy conservation .

Regulatory Interactions

  • Competence in V. fischeri depends on LitR, a quorum-sensing regulator homologous to V. cholerae HapR. RnfE activity intersects with LitR-dependent pathways, particularly in suppressing extracellular DNA degradation by Dns nuclease .

  • Co-overexpression of TfoX and LitR enhances transformation efficiency in less transformable V. fischeri isolates (e.g., KB2B1), implicating RnfE in redox-sensitive genetic regulation .

Domain Architecture

  • RnfE is a subunit of the membrane-bound Rnf complex, which shares structural homology with Na+-translocating NADH:ubiquinone oxidoreductase (Nqr) .

  • Fe-S Clusters: RnfC, a core subunit of the Rnf complex, coordinates 4Fe-4S clusters critical for electron transfer. While RnfE’s direct role in cluster coordination is unconfirmed, its proximity to RnfC suggests involvement in stabilizing the complex .

Evolutionary Conservation

OrganismGene IDHomology (%)Key Function
Vibrio choleraeVCM66_096878%Electron transport, Na+ translocation
Escherichia colirsxE65%Redox balance, fermentative growth
Salmonella newportSNSL254_A156472%Pathogenesis, biofilm formation

Metabolic Engineering

  • Genetic Tool Development: Recombinant RnfE aids in constructing deletion mutants (e.g., ΔflrA) using antibiotic resistance cassettes, enabling studies on motility and biofilm regulation in V. fischeri .

  • Competence Studies: Used to dissect LitR-Dns regulatory axes in DNA uptake, with implications for synthetic biology .

Industrial and Environmental Relevance

  • Bioenergy: The Rnf complex’s Na+-translocating activity is leveraged in bioelectrochemical systems for energy harvesting .

  • Symbiosis Research: V. fischeri’s symbiotic relationship with squid hosts relies on redox-sensitive signaling, where RnfE may modulate host-microbe interactions .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance; additional fees apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rnfE; VFMJ11_0969; Ion-translocating oxidoreductase complex subunit E; Rnf electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Vibrio fischeri (strain MJ11)
Target Names
VFMJ11_0969
Target Protein Sequence
MASHKELIKNGLWDNNPALVQLLGLCPLLAVSATVTNALGLGIATILVLVGSNLIVSLVR QWIPQEVRIPVFVMIIASLVTCVQLLMNAYAYGLYLSLGIFIPLIVTNCIIIGRAESFAS KNDPLPAVLDGLWMGMGMTAVLVLLGAMREILGNGTLFDGADLLLGDWATILRIELFHVD SHFLLAMLPPGAFLGVGFLIALKNVIDKKMADRQPKEKAEIERVRIS
Uniprot No.

Target Background

Function
This protein is a component of a membrane-bound complex that couples electron transfer with ion translocation across the membrane.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is Recombinant RnfE typically expressed and purified for research applications?

For research applications, Recombinant Full Length Vibrio fischeri Electron transport complex protein RnfE is typically expressed in E. coli expression systems. The most common approach involves:

  • Cloning the full-length gene (encoding amino acids 1-227) into an expression vector

  • Adding an N-terminal His-tag to facilitate purification

  • Transforming the construct into an E. coli expression strain

  • Inducing protein expression under optimized conditions

  • Lysing cells and purifying the protein via nickel affinity chromatography

  • Performing quality control through SDS-PAGE to ensure >90% purity

The resulting purified protein is typically provided as a lyophilized powder in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain protein stability during storage and reconstitution . This expression system allows for production of sufficient quantities of protein for various biochemical and structural studies.

What are the optimal storage conditions for maintaining RnfE protein stability?

To maintain optimal stability of Recombinant RnfE protein, researchers should adhere to the following storage guidelines:

  • Store the lyophilized powder at -20°C to -80°C upon receipt

  • Perform aliquoting of reconstituted protein to prevent damage from repeated freeze-thaw cycles

  • For working stocks, maintain at 4°C for up to one week

  • For long-term storage, keep at -80°C in small aliquots

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein activity

Before opening the vial, briefly centrifuge to bring contents to the bottom. Reconstitution should be performed using deionized sterile water to minimize introduction of contaminants . These storage conditions help preserve the structural integrity and functional activity of the protein for experimental applications.

What genetic manipulation techniques are most effective for studying RnfE function in Vibrio fischeri?

When studying RnfE function in Vibrio fischeri, several genetic manipulation techniques have proven effective:

  • PCR-based deletion approach: Using splicing by overlap extension (SOE) with antibiotic resistance cassettes flanked by FRT sequences. This approach allows for clean deletion of the rnfE gene without disrupting adjacent genes .

  • Natural transformation: V. fischeri can undergo natural transformation when the tfoX gene is induced. This facilitates the introduction of PCR products directly into V. fischeri, eliminating the need for plasmid conjugation. While transformation efficiency with PCR products is lower than with plasmid DNA, fragments as large as 10 kb can be transferred .

  • Complementation strategies: For functional verification, complementation can be achieved by reintroducing the rnfE gene at a neutral site in the chromosome (such as between yeiR and glmS). This insertion can be performed using:

    • Native promoter complementation

    • Constitutive promoter expression (using promoters like PnrdR or Pma)

    • Inducible promoter systems (such as the cellobiose-inducible promoter Pcel)

  • Epitope tagging: Adding epitope tags (such as HA-tag) to RnfE enables protein detection via Western blotting, allowing researchers to verify expression levels and localization .

These techniques can be combined to create a comprehensive experimental approach for studying RnfE function, including gene knockout, complementation, and protein detection.

How should I design experiments to evaluate RnfE's role in electron transport and energy metabolism?

When designing experiments to evaluate RnfE's role in electron transport and energy metabolism, consider this systematic approach:

  • Generate clean deletion mutants:

    • Create an rnfE deletion using FRT-flanked antibiotic resistance cassettes

    • Remove the resistance marker using Flp recombinase to create unmarked mutants

    • Verify deletion by PCR and sequencing

  • Phenotypic characterization:

    • Compare growth rates under different electron acceptor conditions

    • Measure membrane potential using fluorescent dyes

    • Quantify ATP production in wild-type versus rnfE mutants

    • Assess NAD+/NADH ratios to determine electron transport efficiency

  • Complementation analysis:

    • Reintroduce rnfE under native or constitutive promoters

    • Compare phenotypic restoration to confirm specificity of observed defects

    • Use inducible promoters to create conditional expression systems

  • Protein-protein interaction studies:

    • Use epitope-tagged RnfE to identify interaction partners via co-immunoprecipitation

    • Apply bacterial two-hybrid systems to map interaction domains

    • Perform blue native PAGE to isolate intact electron transport complexes

  • Biochemical assays:

    • Measure electron transport rates using purified recombinant RnfE

    • Reconstitute RnfE in proteoliposomes to assess transport activity

    • Use site-directed mutagenesis to identify critical residues for function

What reconstitution protocols are recommended for lyophilized Recombinant RnfE?

For optimal reconstitution of lyophilized Recombinant RnfE protein, follow this detailed protocol:

  • Pre-reconstitution preparation:

    • Allow the vial to equilibrate to room temperature (15-20 minutes)

    • Briefly centrifuge at 10,000 × g for 1 minute to collect contents at the bottom

    • Prepare sterile materials and work in a laminar flow hood if possible

  • Reconstitution procedure:

    • Add deionized sterile water to reach desired concentration (typically 0.1-1.0 mg/ml)

    • Gently swirl or rotate the vial until completely dissolved (avoid vigorous vortexing)

    • Allow to stand at room temperature for 10-15 minutes for complete rehydration

    • For membrane proteins like RnfE, consider adding 0.1% mild detergent (such as DDM or CHAPS) to maintain solubility

  • Post-reconstitution handling:

    • Filter through a 0.22 μm filter to remove any particulates

    • Prepare small working aliquots to avoid repeated freeze-thaw cycles

    • Analyze a small sample by SDS-PAGE to verify integrity

  • Stability enhancement:

    • For experiments requiring extended stability, add glycerol to a final concentration of 10%

    • Maintain reconstituted protein at 4°C for short-term use (up to one week)

    • Flash-freeze aliquots in liquid nitrogen for long-term storage at -80°C

This protocol maximizes protein stability and functionality for downstream applications while minimizing degradation.

How can researchers investigate RnfE interactions with other components of the electron transport complex?

Investigating RnfE interactions with other electron transport complex components requires sophisticated experimental approaches:

  • Co-immunoprecipitation with epitope-tagged RnfE:

    • Generate a strain expressing HA-tagged RnfE using PCR SOEing techniques

    • Verify expression by Western blotting with anti-HA antibodies

    • Perform co-immunoprecipitation experiments to identify interacting partners

    • Analyze precipitated proteins by mass spectrometry for identification

  • Bacterial two-hybrid (B2H) analysis:

    • Clone rnfE and candidate interacting genes into B2H vectors

    • Transform into reporter strains and quantify interaction strength

    • Map interaction domains through truncation analysis

    • Validate interactions by reciprocal testing

  • Blue native PAGE:

    • Solubilize membrane fractions with mild detergents

    • Separate native complexes by non-denaturing electrophoresis

    • Identify complex components by second-dimension SDS-PAGE

    • Verify RnfE presence in complexes by Western blotting

  • Crosslinking studies:

    • Apply in vivo crosslinking with membrane-permeable agents

    • Isolate crosslinked complexes via affinity purification

    • Identify crosslinked partners by mass spectrometry

    • Validate specific interactions with targeted mutations

  • Fluorescence-based interaction studies:

    • Generate fluorescent protein fusions to RnfE and potential partners

    • Analyze co-localization by fluorescence microscopy

    • Perform FRET analysis to confirm direct interactions

    • Use BiFC (Bimolecular Fluorescence Complementation) to visualize specific interactions

These methods provide complementary approaches to establish the interaction network of RnfE within the electron transport complex.

What role does RnfE play in Vibrio fischeri symbiosis with marine organisms?

The role of RnfE in Vibrio fischeri symbiosis can be investigated through these methodological approaches:

  • Symbiosis establishment assays:

    • Generate clean rnfE deletion mutants in V. fischeri ES114 strain

    • Inoculate squid hatchlings with wild-type and mutant strains

    • Quantify bacterial colonization efficiency over time

    • Assess competition between wild-type and mutant strains in co-inoculation experiments

  • Metabolic contribution analysis:

    • Compare growth of wild-type and rnfE mutants under symbiosis-relevant conditions

    • Measure oxygen consumption rates during symbiotic growth

    • Analyze transcriptional responses using RNA-seq in symbiotic versus free-living conditions

    • Investigate metabolite exchange between host and bacteria using labeled substrates

  • Integration with other symbiosis systems:

    • Examine coordination between RnfE function and quorum sensing pathways

    • Assess impact on bioluminescence production in light organs

    • Investigate connection to biofilm formation during colonization

    • Study potential role in stress responses during symbiotic establishment

  • Complementation analysis:

    • Reintroduce rnfE under native or constitutive promoters

    • Test for restoration of symbiotic capacity

    • Evaluate whether tagged versions of RnfE maintain symbiotic function

    • Use inducible promoters to control expression during different colonization stages

These approaches will help elucidate how RnfE-mediated electron transport contributes to the unique symbiotic relationship between V. fischeri and its marine hosts.

How can genetic manipulation tools for RnfE studies be adapted for different Vibrio fischeri strains?

Adapting genetic manipulation tools for RnfE studies across different Vibrio fischeri strains requires strategic adjustments:

  • Strain-specific genome analysis:

    • Compare genome sequences to identify strain-specific variations in the rnfE region

    • Adjust primer design to accommodate sequence differences

    • Analyze native promoter sequences for potential regulatory variations

    • Identify suitable neutral integration sites for complementation

  • Transformation optimization:

    • Adapt natural transformation protocols for each strain

    • Test different DNA concentrations and competence induction conditions

    • Optimize selection conditions based on strain-specific antibiotic sensitivities

    • Consider alternative delivery methods if natural transformation is inefficient

  • Antibiotic marker selection:

    • Screen strains for intrinsic antibiotic resistances

    • Select appropriate markers from the available cassette collection (Em, Cm, Tc, Tm, Sp, or Zc)

    • Adjust antibiotic concentrations based on strain-specific minimum inhibitory concentrations

    • Consider using alternative markers if standard options show cross-resistance

  • Complementation strategies:

    • Test multiple neutral integration sites if yeiR-glmS region differs between strains

    • Evaluate both native and synthetic promoters for consistent expression

    • Consider using broad-host-range complementation plasmids if chromosomal integration is challenging

    • Use constitutive promoters (PnrdR or Pma) when native promoter sequences are poorly defined

This adaptive approach enables consistent genetic manipulation across diverse V. fischeri strains, facilitating comparative studies of RnfE function in different genetic backgrounds.

What analytical methods should be used to verify the purity and functionality of Recombinant RnfE?

To ensure high-quality experimental results, verify Recombinant RnfE purity and functionality using these analytical approaches:

  • Purity assessment:

    • SDS-PAGE analysis with Coomassie staining (should show >90% purity)

    • Western blotting with anti-His antibodies to confirm target protein identity

    • Mass spectrometry to verify protein mass and identify potential contaminants

    • Size exclusion chromatography to assess aggregation state

  • Structural integrity verification:

    • Circular dichroism spectroscopy to analyze secondary structure elements

    • Fluorescence spectroscopy to assess tertiary structure

    • Limited proteolysis to evaluate proper folding

    • Dynamic light scattering to examine homogeneity and aggregation status

  • Functional activity testing:

    • Reconstitution into proteoliposomes to measure electron transport activity

    • NADH oxidation assays to assess electron transfer capability

    • Membrane potential measurements using fluorescent dyes

    • ATP synthesis coupling assays in reconstituted systems

  • Stability analysis:

    • Thermal shift assays to determine melting temperature

    • Time-course activity measurements to assess functional half-life

    • Storage stability tests under different conditions

    • Freeze-thaw tolerance evaluation

Analytical MethodPrimary InformationDetection LimitSample Requirement
SDS-PAGEPurity, molecular weight~0.1 μg protein5-20 μg total protein
Western BlotIdentity confirmation~10 ng protein50-200 ng protein
Mass SpectrometryExact mass, modifications1-10 pmol0.1-1 μg protein
Circular DichroismSecondary structure0.1 mg/ml200 μl at 0.1-0.5 mg/ml
Activity AssaysFunctional capacityAssay-dependent1-10 μg protein

These analytical approaches provide complementary information about protein quality and functionality, ensuring reliable experimental outcomes.

What are common challenges when working with membrane proteins like RnfE and how can they be addressed?

Membrane proteins like RnfE present specific experimental challenges that can be addressed through optimized methodologies:

  • Solubility limitations:

    • Challenge: Precipitation during purification and handling

    • Solution: Screen multiple detergents (DDM, LMNG, CHAPS) for optimal solubilization

    • Approach: Utilize amphipols or nanodiscs for detergent-free stabilization

    • Validation: Monitor solubility using dynamic light scattering or ultracentrifugation

  • Conformational instability:

    • Challenge: Loss of native structure during purification

    • Solution: Include stabilizing agents (glycerol, specific lipids, cholesterol hemisuccinate)

    • Approach: Maintain constant detergent concentration above critical micelle concentration

    • Validation: Assess activity retention through time-course functional assays

  • Expression difficulties:

    • Challenge: Low expression yields in heterologous systems

    • Solution: Optimize codon usage for E. coli expression

    • Approach: Test specialized membrane protein expression strains (C41/C43, Lemo21)

    • Validation: Compare expression levels by Western blotting across conditions

  • Functional reconstitution:

    • Challenge: Loss of activity when removed from native membrane environment

    • Solution: Reconstitute into liposomes with defined lipid composition

    • Approach: Co-express with interacting partners to maintain complex integrity

    • Validation: Compare activity in different reconstitution systems

  • Structural analysis limitations:

    • Challenge: Difficulty obtaining structural information

    • Solution: Utilize detergent-resistant fusion partners (T4 lysozyme, BRIL)

    • Approach: Apply cryo-EM for structure determination without crystallization

    • Validation: Complement structural studies with biochemical crosslinking

These tailored approaches address the specific challenges of membrane protein biochemistry, enhancing experimental success with RnfE.

How should contradictory results in RnfE functional studies be interpreted and reconciled?

When facing contradictory results in RnfE functional studies, apply this systematic approach to interpretation and reconciliation:

  • Methodological differences assessment:

    • Compare experimental conditions in detail (buffer composition, pH, salt concentration)

    • Evaluate protein preparation methods (detergents, purification strategy, tags)

    • Assess functional assay variations (substrate concentrations, detection methods)

    • Create a comparison table of methodological differences to identify critical variables

  • Strain-specific variations analysis:

    • Compare RnfE sequences between different V. fischeri strains used

    • Examine genetic background differences that might influence RnfE function

    • Consider regulatory network variations that could affect expression patterns

    • Perform cross-complementation studies between strains

  • Protein context consideration:

    • Evaluate whether RnfE was studied in isolation or as part of its native complex

    • Assess potential effects of epitope tags on protein function

    • Consider membrane composition differences between experimental systems

    • Examine potential post-translational modifications affecting activity

  • Systematic validation approach:

    • Design experiments that directly test contradictory findings

    • Perform side-by-side comparisons under identical conditions

    • Utilize multiple complementary techniques to measure the same parameter

    • Develop quantitative assays with appropriate controls for each variable

  • Collaborative resolution strategy:

    • Exchange materials between laboratories reporting contradictory results

    • Standardize protocols through detailed method sharing

    • Perform parallel experiments with identical reagents

    • Consider joint publication addressing and resolving contradictions

This systematic approach transforms contradictory results from obstacles into opportunities for deeper mechanistic understanding of RnfE function.

What emerging technologies will advance our understanding of RnfE function in Vibrio fischeri?

Emerging technologies offer new opportunities for investigating RnfE function:

  • CRISPR-Cas9 genome editing:

    • Application: Precise editing of rnfE without antibiotic markers

    • Advantage: Reduced polar effects and faster strain construction

    • Implementation: Develop optimized CRISPR-Cas9 delivery systems for V. fischeri

    • Integration: Combine with existing genetic tools for enhanced manipulation

  • Cryo-electron microscopy:

    • Application: High-resolution structural analysis of RnfE within native complexes

    • Advantage: Visualization of membrane protein complexes without crystallization

    • Implementation: Isolate intact RnfE-containing complexes through gentle purification

    • Integration: Correlate structure with functional studies for mechanistic insights

  • Single-molecule techniques:

    • Application: Real-time monitoring of electron transport through individual complexes

    • Advantage: Reveals dynamic functional states masked in bulk measurements

    • Implementation: Develop fluorescent probes for tracking electron movement

    • Integration: Correlate with bulk biochemical assays for comprehensive understanding

  • Synthetic biology approaches:

    • Application: Engineering RnfE variants with altered or enhanced functions

    • Advantage: Reveals structure-function relationships through rational design

    • Implementation: Design and test RnfE chimeras with domains from related proteins

    • Integration: Combine with complementation studies to validate in vivo

These emerging technologies will provide unprecedented insights into RnfE function, advancing our understanding of electron transport mechanisms in bacterial systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.