Amino Acid Sequence: Comprises 227 residues (1-227aa) with the sequence:
MASHKELIKNGLWDNNPALVQLLGLCPLLAVSATVTNALGLGIATILVLVGSNLIVSLVRQWIPQEVRIPVFVMIIASLVTCVQLLMNAYAYGLYLSLGIFIPLIVTNCIIIGRAESFASKNDPLPAVLDGLWMGMGMTAVLVLLGAMREILGNGTLFDGADLLLGDWATILRIELFHVDSHFLLAMLPPGAFLGVGFLIALKNVIDKKMADRQPKEKAEIERVRIS .
Gene Information: Encoded by the gene VFMJ11_0969 (synonyms: rnfE, Ion-translocating oxidoreductase complex subunit E) .
The Rnf complex (including RnfE) couples electron transfer from reduced ferredoxin to NAD+, generating a sodium ion gradient across the membrane .
In V. fischeri, RnfE is essential for competence development under conditions of TfoX overexpression, facilitating DNA uptake via redox-driven energy conservation .
Competence in V. fischeri depends on LitR, a quorum-sensing regulator homologous to V. cholerae HapR. RnfE activity intersects with LitR-dependent pathways, particularly in suppressing extracellular DNA degradation by Dns nuclease .
Co-overexpression of TfoX and LitR enhances transformation efficiency in less transformable V. fischeri isolates (e.g., KB2B1), implicating RnfE in redox-sensitive genetic regulation .
RnfE is a subunit of the membrane-bound Rnf complex, which shares structural homology with Na+-translocating NADH:ubiquinone oxidoreductase (Nqr) .
Fe-S Clusters: RnfC, a core subunit of the Rnf complex, coordinates 4Fe-4S clusters critical for electron transfer. While RnfE’s direct role in cluster coordination is unconfirmed, its proximity to RnfC suggests involvement in stabilizing the complex .
Genetic Tool Development: Recombinant RnfE aids in constructing deletion mutants (e.g., ΔflrA) using antibiotic resistance cassettes, enabling studies on motility and biofilm regulation in V. fischeri .
Competence Studies: Used to dissect LitR-Dns regulatory axes in DNA uptake, with implications for synthetic biology .
KEGG: vfm:VFMJ11_0969
For research applications, Recombinant Full Length Vibrio fischeri Electron transport complex protein RnfE is typically expressed in E. coli expression systems. The most common approach involves:
Cloning the full-length gene (encoding amino acids 1-227) into an expression vector
Adding an N-terminal His-tag to facilitate purification
Transforming the construct into an E. coli expression strain
Inducing protein expression under optimized conditions
Lysing cells and purifying the protein via nickel affinity chromatography
Performing quality control through SDS-PAGE to ensure >90% purity
The resulting purified protein is typically provided as a lyophilized powder in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain protein stability during storage and reconstitution . This expression system allows for production of sufficient quantities of protein for various biochemical and structural studies.
To maintain optimal stability of Recombinant RnfE protein, researchers should adhere to the following storage guidelines:
Store the lyophilized powder at -20°C to -80°C upon receipt
Perform aliquoting of reconstituted protein to prevent damage from repeated freeze-thaw cycles
For working stocks, maintain at 4°C for up to one week
For long-term storage, keep at -80°C in small aliquots
Avoid repeated freeze-thaw cycles as this significantly reduces protein activity
Before opening the vial, briefly centrifuge to bring contents to the bottom. Reconstitution should be performed using deionized sterile water to minimize introduction of contaminants . These storage conditions help preserve the structural integrity and functional activity of the protein for experimental applications.
When studying RnfE function in Vibrio fischeri, several genetic manipulation techniques have proven effective:
PCR-based deletion approach: Using splicing by overlap extension (SOE) with antibiotic resistance cassettes flanked by FRT sequences. This approach allows for clean deletion of the rnfE gene without disrupting adjacent genes .
Natural transformation: V. fischeri can undergo natural transformation when the tfoX gene is induced. This facilitates the introduction of PCR products directly into V. fischeri, eliminating the need for plasmid conjugation. While transformation efficiency with PCR products is lower than with plasmid DNA, fragments as large as 10 kb can be transferred .
Complementation strategies: For functional verification, complementation can be achieved by reintroducing the rnfE gene at a neutral site in the chromosome (such as between yeiR and glmS). This insertion can be performed using:
Epitope tagging: Adding epitope tags (such as HA-tag) to RnfE enables protein detection via Western blotting, allowing researchers to verify expression levels and localization .
These techniques can be combined to create a comprehensive experimental approach for studying RnfE function, including gene knockout, complementation, and protein detection.
When designing experiments to evaluate RnfE's role in electron transport and energy metabolism, consider this systematic approach:
Generate clean deletion mutants:
Phenotypic characterization:
Compare growth rates under different electron acceptor conditions
Measure membrane potential using fluorescent dyes
Quantify ATP production in wild-type versus rnfE mutants
Assess NAD+/NADH ratios to determine electron transport efficiency
Complementation analysis:
Protein-protein interaction studies:
Use epitope-tagged RnfE to identify interaction partners via co-immunoprecipitation
Apply bacterial two-hybrid systems to map interaction domains
Perform blue native PAGE to isolate intact electron transport complexes
Biochemical assays:
Measure electron transport rates using purified recombinant RnfE
Reconstitute RnfE in proteoliposomes to assess transport activity
Use site-directed mutagenesis to identify critical residues for function
For optimal reconstitution of lyophilized Recombinant RnfE protein, follow this detailed protocol:
Pre-reconstitution preparation:
Allow the vial to equilibrate to room temperature (15-20 minutes)
Briefly centrifuge at 10,000 × g for 1 minute to collect contents at the bottom
Prepare sterile materials and work in a laminar flow hood if possible
Reconstitution procedure:
Add deionized sterile water to reach desired concentration (typically 0.1-1.0 mg/ml)
Gently swirl or rotate the vial until completely dissolved (avoid vigorous vortexing)
Allow to stand at room temperature for 10-15 minutes for complete rehydration
For membrane proteins like RnfE, consider adding 0.1% mild detergent (such as DDM or CHAPS) to maintain solubility
Post-reconstitution handling:
Stability enhancement:
For experiments requiring extended stability, add glycerol to a final concentration of 10%
Maintain reconstituted protein at 4°C for short-term use (up to one week)
Flash-freeze aliquots in liquid nitrogen for long-term storage at -80°C
This protocol maximizes protein stability and functionality for downstream applications while minimizing degradation.
Investigating RnfE interactions with other electron transport complex components requires sophisticated experimental approaches:
Co-immunoprecipitation with epitope-tagged RnfE:
Bacterial two-hybrid (B2H) analysis:
Clone rnfE and candidate interacting genes into B2H vectors
Transform into reporter strains and quantify interaction strength
Map interaction domains through truncation analysis
Validate interactions by reciprocal testing
Blue native PAGE:
Solubilize membrane fractions with mild detergents
Separate native complexes by non-denaturing electrophoresis
Identify complex components by second-dimension SDS-PAGE
Verify RnfE presence in complexes by Western blotting
Crosslinking studies:
Apply in vivo crosslinking with membrane-permeable agents
Isolate crosslinked complexes via affinity purification
Identify crosslinked partners by mass spectrometry
Validate specific interactions with targeted mutations
Fluorescence-based interaction studies:
Generate fluorescent protein fusions to RnfE and potential partners
Analyze co-localization by fluorescence microscopy
Perform FRET analysis to confirm direct interactions
Use BiFC (Bimolecular Fluorescence Complementation) to visualize specific interactions
These methods provide complementary approaches to establish the interaction network of RnfE within the electron transport complex.
The role of RnfE in Vibrio fischeri symbiosis can be investigated through these methodological approaches:
Symbiosis establishment assays:
Generate clean rnfE deletion mutants in V. fischeri ES114 strain
Inoculate squid hatchlings with wild-type and mutant strains
Quantify bacterial colonization efficiency over time
Assess competition between wild-type and mutant strains in co-inoculation experiments
Metabolic contribution analysis:
Compare growth of wild-type and rnfE mutants under symbiosis-relevant conditions
Measure oxygen consumption rates during symbiotic growth
Analyze transcriptional responses using RNA-seq in symbiotic versus free-living conditions
Investigate metabolite exchange between host and bacteria using labeled substrates
Integration with other symbiosis systems:
Complementation analysis:
These approaches will help elucidate how RnfE-mediated electron transport contributes to the unique symbiotic relationship between V. fischeri and its marine hosts.
Adapting genetic manipulation tools for RnfE studies across different Vibrio fischeri strains requires strategic adjustments:
Strain-specific genome analysis:
Transformation optimization:
Adapt natural transformation protocols for each strain
Test different DNA concentrations and competence induction conditions
Optimize selection conditions based on strain-specific antibiotic sensitivities
Consider alternative delivery methods if natural transformation is inefficient
Antibiotic marker selection:
Screen strains for intrinsic antibiotic resistances
Select appropriate markers from the available cassette collection (Em, Cm, Tc, Tm, Sp, or Zc)
Adjust antibiotic concentrations based on strain-specific minimum inhibitory concentrations
Consider using alternative markers if standard options show cross-resistance
Complementation strategies:
Test multiple neutral integration sites if yeiR-glmS region differs between strains
Evaluate both native and synthetic promoters for consistent expression
Consider using broad-host-range complementation plasmids if chromosomal integration is challenging
Use constitutive promoters (PnrdR or Pma) when native promoter sequences are poorly defined
This adaptive approach enables consistent genetic manipulation across diverse V. fischeri strains, facilitating comparative studies of RnfE function in different genetic backgrounds.
To ensure high-quality experimental results, verify Recombinant RnfE purity and functionality using these analytical approaches:
Purity assessment:
Structural integrity verification:
Circular dichroism spectroscopy to analyze secondary structure elements
Fluorescence spectroscopy to assess tertiary structure
Limited proteolysis to evaluate proper folding
Dynamic light scattering to examine homogeneity and aggregation status
Functional activity testing:
Reconstitution into proteoliposomes to measure electron transport activity
NADH oxidation assays to assess electron transfer capability
Membrane potential measurements using fluorescent dyes
ATP synthesis coupling assays in reconstituted systems
Stability analysis:
Thermal shift assays to determine melting temperature
Time-course activity measurements to assess functional half-life
Storage stability tests under different conditions
Freeze-thaw tolerance evaluation
| Analytical Method | Primary Information | Detection Limit | Sample Requirement |
|---|---|---|---|
| SDS-PAGE | Purity, molecular weight | ~0.1 μg protein | 5-20 μg total protein |
| Western Blot | Identity confirmation | ~10 ng protein | 50-200 ng protein |
| Mass Spectrometry | Exact mass, modifications | 1-10 pmol | 0.1-1 μg protein |
| Circular Dichroism | Secondary structure | 0.1 mg/ml | 200 μl at 0.1-0.5 mg/ml |
| Activity Assays | Functional capacity | Assay-dependent | 1-10 μg protein |
These analytical approaches provide complementary information about protein quality and functionality, ensuring reliable experimental outcomes.
Membrane proteins like RnfE present specific experimental challenges that can be addressed through optimized methodologies:
Solubility limitations:
Challenge: Precipitation during purification and handling
Solution: Screen multiple detergents (DDM, LMNG, CHAPS) for optimal solubilization
Approach: Utilize amphipols or nanodiscs for detergent-free stabilization
Validation: Monitor solubility using dynamic light scattering or ultracentrifugation
Conformational instability:
Challenge: Loss of native structure during purification
Solution: Include stabilizing agents (glycerol, specific lipids, cholesterol hemisuccinate)
Approach: Maintain constant detergent concentration above critical micelle concentration
Validation: Assess activity retention through time-course functional assays
Expression difficulties:
Functional reconstitution:
Challenge: Loss of activity when removed from native membrane environment
Solution: Reconstitute into liposomes with defined lipid composition
Approach: Co-express with interacting partners to maintain complex integrity
Validation: Compare activity in different reconstitution systems
Structural analysis limitations:
Challenge: Difficulty obtaining structural information
Solution: Utilize detergent-resistant fusion partners (T4 lysozyme, BRIL)
Approach: Apply cryo-EM for structure determination without crystallization
Validation: Complement structural studies with biochemical crosslinking
These tailored approaches address the specific challenges of membrane protein biochemistry, enhancing experimental success with RnfE.
When facing contradictory results in RnfE functional studies, apply this systematic approach to interpretation and reconciliation:
Methodological differences assessment:
Compare experimental conditions in detail (buffer composition, pH, salt concentration)
Evaluate protein preparation methods (detergents, purification strategy, tags)
Assess functional assay variations (substrate concentrations, detection methods)
Create a comparison table of methodological differences to identify critical variables
Strain-specific variations analysis:
Protein context consideration:
Evaluate whether RnfE was studied in isolation or as part of its native complex
Assess potential effects of epitope tags on protein function
Consider membrane composition differences between experimental systems
Examine potential post-translational modifications affecting activity
Systematic validation approach:
Design experiments that directly test contradictory findings
Perform side-by-side comparisons under identical conditions
Utilize multiple complementary techniques to measure the same parameter
Develop quantitative assays with appropriate controls for each variable
Collaborative resolution strategy:
Exchange materials between laboratories reporting contradictory results
Standardize protocols through detailed method sharing
Perform parallel experiments with identical reagents
Consider joint publication addressing and resolving contradictions
This systematic approach transforms contradictory results from obstacles into opportunities for deeper mechanistic understanding of RnfE function.
Emerging technologies offer new opportunities for investigating RnfE function:
CRISPR-Cas9 genome editing:
Cryo-electron microscopy:
Application: High-resolution structural analysis of RnfE within native complexes
Advantage: Visualization of membrane protein complexes without crystallization
Implementation: Isolate intact RnfE-containing complexes through gentle purification
Integration: Correlate structure with functional studies for mechanistic insights
Single-molecule techniques:
Application: Real-time monitoring of electron transport through individual complexes
Advantage: Reveals dynamic functional states masked in bulk measurements
Implementation: Develop fluorescent probes for tracking electron movement
Integration: Correlate with bulk biochemical assays for comprehensive understanding
Synthetic biology approaches:
Application: Engineering RnfE variants with altered or enhanced functions
Advantage: Reveals structure-function relationships through rational design
Implementation: Design and test RnfE chimeras with domains from related proteins
Integration: Combine with complementation studies to validate in vivo
These emerging technologies will provide unprecedented insights into RnfE function, advancing our understanding of electron transport mechanisms in bacterial systems.