Recombinant Vibrio fischeri Electron transport complex protein RnfG (rnfG)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant V. fischeri RnfG is a 210-amino-acid protein (UniProt ID: B5FCN1) fused to an N-terminal His tag for purification (Table 1). It forms part of the Rnf complex, a six-subunit redox-driven ion pump that couples electron transfer between ferredoxin and NAD⁺/NADP⁺ to generate ion gradients .

Table 2: RnfG Functional Conservation Across Species

OrganismFMN Ligand PositionLocalizationElectron Acceptor
Vibrio fischeriThr-175Periplasmic-facingCytochrome c
Methanosarcina acetivoransThr-166Periplasmic-facingHeterodisulfide reductase
Vibrio choleraeThr-175Periplasmic-facingQuinones

Key Research Findings

  1. FMN Dependency: RnfG requires covalently bound FMN for redox activity; Thr→Gly mutations abolish function .

  2. Topological Validation: Fusion proteins (e.g., GFP, alkaline phosphatase) confirmed the periplasmic orientation of the FMN domain .

  3. Electron Transfer Blockers: Rotenone inhibits electron flow between RnfB and RnfG, highlighting shared mechanisms with mitochondrial Complex I .

Open Questions and Future Directions

  • Ion Specificity: Whether RnfG directly participates in Na⁺/H⁺ translocation remains unresolved .

  • Structural Data: High-resolution structures of full-length RnfG are needed to map FMN-environment interactions.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rnfG; VFMJ11_0970; Ion-translocating oxidoreductase complex subunit G; Rnf electron transport complex subunit G
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-210
Protein Length
full length protein
Species
Vibrio fischeri (strain MJ11)
Target Names
VFMJ11_0970
Target Protein Sequence
MLTTMKKSSLVLALFAIAATALVTITYALTKDQIAYQQQQQLLSVLNQVVPKEQHDNELY KACILVKNNDALGSKQAMPIYLASLNGKHSGAAIEAIAPDGYSGNIKIIVGVDSDAIVTG VRVLSHQETPGLGDKIDIRITRWVDAFLGKTVESSEDKNWAVQKDGGQFDQFTGATITPR AVVKAVKRAVWFYKTHQEELLTLPLNCETK
Uniprot No.

Target Background

Function
A component of a membrane-bound complex that facilitates coupling between electron transfer and ion translocation across the membrane.
Database Links
Protein Families
RnfG family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the RnfG protein and what is its role in Vibrio fischeri?

The RnfG protein (also known as VFMJ11_0970) is a subunit of the ion-translocating oxidoreductase complex (Rnf complex) in Vibrio fischeri. This protein functions as part of the electron transport chain, facilitating the transfer of electrons between electron donors and acceptors while contributing to energy conservation through ion translocation. In V. fischeri, this protein is likely involved in respiratory metabolism, potentially supporting both the free-living marine lifestyle and the bioluminescent symbiotic relationship this bacterium forms with marine animals. The RnfG subunit specifically contributes to the structural integrity and functional capacity of the larger Rnf complex, which couples electron transfer with ion translocation across the bacterial membrane .

What is the molecular structure of recombinant RnfG protein?

Recombinant RnfG from Vibrio fischeri is a full-length protein consisting of 210 amino acids. The complete amino acid sequence is: MLTTMKKSSLVLALFAIAATALVTITYALTKDQIAYQQQQQLLSVLNQVVPKEQHDNELYKACIILVKNNDALGSKQAMPIYLASLNGKHSGAAIEAIAPDGYSGNIKIIVGVDSDAIVTGVRVLSHQETPGLGDKIDIRITRWVDAFLGKTVESSEDKNWAVQKDGGQFDQFTGATITPRAVVKAVKRAVWFYKTHQEELLTLPLNCETK . The protein contains transmembrane regions, as suggested by the hydrophobic amino acid clusters in its sequence. For research applications, it's commonly expressed with an N-terminal His-tag to facilitate purification and detection. The recombinant version maintains the functional domains of the native protein while providing convenient features for laboratory manipulation .

How does the RnfG protein fit into the broader electron transport system of Vibrio fischeri?

The RnfG protein functions as part of a larger electron transport complex in V. fischeri, contributing to the bacterial respiratory electron transport system (ETS). Unlike simplified artificial systems created for research purposes, the native bacterial ETS is branched to allow condition-specific modulation of energy metabolism . RnfG likely participates in one of these respiratory branches, potentially contributing to proton or sodium ion translocation coupled with electron transfer. This process generates electrochemical gradients that can be used for ATP synthesis.

In the context of the complete V. fischeri ETS, RnfG's function should be understood as part of a sophisticated network that includes various dehydrogenases, quinones, and terminal reductases. This system allows the bacterium to adapt its energy generation pathways in response to environmental conditions, particularly important for a bacterium that transitions between free-living and symbiotic states .

What are the optimal conditions for working with recombinant RnfG protein in vitro?

To effectively work with recombinant V. fischeri RnfG protein in vitro, researchers should consider the following optimized conditions:

  • Reconstitution: The lyophilized recombinant protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 5-50% is recommended for long-term storage stability .

  • Storage conditions: Store the reconstituted protein at -20°C to -80°C, with aliquoting being essential to avoid repeated freeze-thaw cycles. Working aliquots can be stored at 4°C for up to one week .

  • Buffer conditions: The protein is typically provided in a Tris/PBS-based buffer with 6% trehalose at pH 8.0, which supports protein stability. For functional assays, maintaining a similar pH range (7.5-8.5) is recommended to preserve native conformation .

  • Temperature considerations: Given that V. fischeri thrives at 24-28°C and experiences lethality at temperatures above 34°C, experimental work with the protein should typically be conducted between 20-30°C to maintain physiological relevance .

These conditions ensure optimal protein stability and activity for in vitro experimental applications, including functional assays, protein-protein interaction studies, and structural analyses.

What methods are most effective for assessing RnfG functionality in electron transport studies?

When assessing RnfG functionality in electron transport studies, several complementary methodological approaches yield the most comprehensive results:

  • Spectrophotometric redox assays: Monitor electron transfer activities using artificial electron donors (NADH, NADPH) and acceptors (various quinones, artificial electron acceptors like ferricyanide) by tracking absorbance changes at specific wavelengths. This approach provides quantitative measures of electron transfer rates and can be conducted with isolated RnfG protein or membrane preparations containing the entire Rnf complex.

  • Membrane potential measurements: Since RnfG is part of an ion-translocating complex, assess its functionality by measuring membrane potential generation using fluorescent probes (e.g., DiSC3(5), TMRM) in reconstituted proteoliposomes or in whole cells with genetic manipulations of the rnfG gene.

  • Oxygen consumption analysis: If RnfG indirectly contributes to oxygen respiration pathways, oxygen consumption rates can be measured using oxygen electrodes or optical sensors when supplying appropriate substrates.

  • Comparative analysis with ETS variants: Following the approach described in the literature, create controlled ETS variants with different H+/e− ratios and compare their bioenergetic profiles. This would involve generating deletion strains and complementation constructs to isolate the specific contribution of RnfG to electron transport efficiency .

The most robust research approach combines multiple methods to establish correlations between structural features, electron transfer capabilities, and ion-translocating functions of the RnfG protein in the context of the complete Rnf complex.

How can researchers effectively express and purify recombinant RnfG for structural studies?

For high-quality expression and purification of recombinant RnfG suitable for structural studies, researchers should follow this optimized protocol:

  • Expression system selection: The E. coli BL21(DE3) strain is recommended for expression, as it has been successfully used for recombinant RnfG production . For membrane proteins like RnfG, specialized strains such as C41(DE3) or C43(DE3) may provide improved expression.

  • Expression vector design: Construct an expression vector with an N-terminal His-tag, incorporating a cleavable linker if tag-free protein is eventually required for structural studies. The commercial construct utilizes an N-terminal His-tag with the full-length protein (amino acids 1-210) .

  • Optimized expression conditions:

    • Culture medium: Use rich media (e.g., TB or 2YT) supplemented with appropriate antibiotics

    • Induction: IPTG concentration of 0.1-0.5 mM at OD600 of 0.6-0.8

    • Post-induction temperature: 16-18°C for 16-20 hours to promote proper folding

    • Consider including membrane-stabilizing additives like glycerol (5-10%)

  • Purification strategy:

    • Membrane preparation: Lyse cells using a combination of enzymatic treatment and mechanical disruption

    • Solubilization: Extract membrane proteins using mild detergents (DDM, LMNG, or Triton X-100)

    • IMAC purification: Use Ni-NTA or similar resin for initial purification

    • Size exclusion chromatography: Further purify using gel filtration to obtain homogeneous protein

    • Consider detergent exchange during purification if required for downstream applications

  • Quality control assessments:

    • SDS-PAGE for purity (target >90% purity)

    • Western blot for identity confirmation

    • Mass spectrometry for sequence verification

    • Dynamic light scattering for homogeneity assessment

For structural studies specifically, researchers should also evaluate protein stability in various buffer conditions using thermal shift assays and monitor monodispersity through analytical SEC to identify optimal conditions for crystallization or cryo-EM sample preparation.

How does RnfG contribute to the proton-motive force generation in comparison to other electron transport components?

The contribution of RnfG to proton-motive force (PMF) generation represents a sophisticated aspect of bacterial bioenergetics that can be analyzed through comparative assessments with other electron transport components:

In bacterial electron transport systems, proteins contribute differently to PMF generation based on their position in the respiratory chain and their specific mechanisms. Research comparing unbranched electron transport system (ETS) variants has shown that different combinations of dehydrogenases and oxidoreductases result in systems that pump 1, 2, 3, or 4 protons per electron (H+/e−) . The Rnf complex, of which RnfG is a component, likely contributes to this process in a manner distinct from other known respiratory complexes.

ETS Component TypeH+/e− RatioATP YieldGrowth Impact in Unbranched Systems
NDH-II only~1LowerSignificant growth compromise
NDH-I containing~2-3MediumLess growth retardation
Cytochrome bd O₂REDs~2MediumVariable growth effects
Cytochrome bo₃ O₂REDs~3-4HigherOptimized with adaptation
Rnf complex (including RnfG)Not specified in dataUnknownRequires investigation

Based on evolutionary adaptation studies of ETS variants, despite different initial growth phenotypes, laboratory evolution allows these variants to optimize to similar growth rates through metabolic rewiring . This suggests that RnfG's contribution to PMF might be complemented or compensated by adaptive changes in other energy-generating pathways.

For researchers investigating RnfG specifically, comparative analyses between wild-type strains and rnfG deletion mutants, coupled with measurements of membrane potential, ATP production, and growth rates under various conditions, would provide quantitative assessments of this protein's specific contribution to cellular bioenergetics. Additionally, proteome allocation studies similar to those performed for other ETS components could reveal how cells balance the expression of RnfG against other energy-generating proteins based on their relative efficiency and metabolic costs .

What role might RnfG play in the bioluminescent symbiosis between Vibrio fischeri and marine organisms?

RnfG likely serves as a critical component in the energy metabolism network that supports the bioluminescent symbiosis between Vibrio fischeri and marine organisms such as the Hawaiian bobtail squid Euprymna scolopes. This relationship represents a sophisticated biological interaction where energy metabolism, quorum sensing, and bioluminescence are intricately connected.

While the search results don't explicitly link RnfG to symbiosis, we can make informed inferences based on what we know about V. fischeri's symbiotic relationship and the general importance of electron transport in supporting energy-intensive processes like bioluminescence:

  • Energy metabolism for bioluminescence: Bioluminescence requires significant energy input, and as a component of the electron transport system, RnfG likely contributes to the generation of membrane potential and ATP synthesis necessary to fuel the light-producing luciferase reaction.

  • Regulation by global regulators: The search results indicate that σ54 (encoded by rpoN) controls bioluminescence, biofilm formation, and motility in V. fischeri . Since these processes are critical for successful symbiotic colonization, and electron transport is fundamental to cellular energetics, RnfG may be part of the σ54 regulon, potentially connecting energy metabolism to symbiotic functions.

  • Adaptation to symbiotic microenvironment: The squid light organ represents a distinct environment compared to the open ocean. RnfG might be involved in adapting V. fischeri's energy metabolism to optimize growth and bioluminescence within this specialized niche. The electron transport system needs to function efficiently under the specific oxygen tensions and nutrient conditions found in the light organ.

  • Potential role in biofilm formation: Successful colonization of the squid light organ involves biofilm formation, which requires coordinated energy metabolism. As part of the electron transport machinery, RnfG may indirectly support this process by ensuring adequate energy supply during the initial stages of colonization.

Future research directions could include:

  • Creating rnfG deletion mutants and testing their colonization efficiency in squid models

  • Examining RnfG expression levels during different stages of symbiotic establishment

  • Investigating whether RnfG function is modulated by symbiosis-specific signals

  • Determining if RnfG contributes to the bacterium's ability to respond to the changing conditions within the light organ microenvironment

How can adaptive laboratory evolution approaches be applied to understand RnfG function in modified electron transport systems?

Adaptive Laboratory Evolution (ALE) provides a powerful approach to understand RnfG function in modified electron transport systems by allowing researchers to observe how bacteria compensate for alterations in electron transport components over evolutionary timescales. Based on methodologies described in the literature, researchers could implement the following experimental strategy:

  • Creation of electron transport variants: Generate a series of V. fischeri strains with modifications to the Rnf complex, including:

    • Complete deletion of rnfG

    • Point mutations in conserved residues of RnfG

    • Chimeric RnfG proteins incorporating domains from related species

    • Unbranched ETS pathways that either include or exclude the Rnf complex

  • Parallel evolution experiments: Conduct long-term laboratory evolution experiments (typically 500-1000 generations) with multiple replicates of each variant under controlled conditions that challenge electron transport capacity, such as:

    • Varying oxygen concentrations

    • Different carbon sources with altered reduction states

    • Fluctuating salt concentrations to mimic natural marine environments

    • Conditions mimicking the squid light organ environment

  • Multi-omic analysis: As demonstrated in recent research on ETS variants , apply a comprehensive suite of analytical techniques to evolved strains:

Analysis TypeMethodologyInsights Provided
GenomicWhole-genome sequencingIdentify adaptive mutations
TranscriptomicRNA-seqDetermine expression changes in related pathways
ProteomicLC-MS/MSQuantify protein level adaptations
MetabolomicGC-MS and LC-MSIdentify metabolic rewiring
Fluxomic13C metabolic flux analysisMeasure changes in carbon flow
PhenotypicGrowth, respiration, membrane potentialAssess functional outcomes
  • Computational modeling: Develop constraint-based models of V. fischeri metabolism with a focus on proteome allocation, similar to the ME-models referenced in the literature . These models can predict how the proteome is reallocated in response to RnfG modifications and validate experimental observations.

  • Evolutionary trajectory analysis: Compare the evolutionary pathways taken by different strains to determine if there are convergent solutions to the loss or modification of RnfG function, providing insights into its physiological importance and potential redundancies in the electron transport network.

This approach would reveal not only the direct functions of RnfG but also how the bacterial cell can compensate for alterations in this protein through evolutionary processes, offering a systems-level understanding of RnfG's role in bacterial bioenergetics and adaptation.

What are common challenges when working with recombinant RnfG protein and how can they be addressed?

Researchers working with recombinant Vibrio fischeri RnfG protein often encounter several technical challenges. The following table outlines common issues and provides detailed solutions:

ChallengePotential CausesSolutions
Low expression yieldToxicity to expression host, inclusion body formation1. Use specialized E. coli strains (C41/C43) designed for membrane proteins
2. Lower induction temperature to 16°C
3. Reduce IPTG concentration to 0.1-0.2 mM
4. Co-express with chaperones (GroEL/GroES)
Poor solubilityMembrane protein characteristics, improper detergent selection1. Screen multiple detergents (DDM, LMNG, CHAPS)
2. Try detergent mixtures (e.g., DDM with CHS)
3. Consider using amphipols or nanodiscs for stabilization
4. Optimize salt concentration (150-500 mM)
Protein aggregation after purificationDetergent concentration below CMC, protein instability1. Maintain detergent above CMC throughout purification
2. Add glycerol (10-20%) to stabilize
3. Include reducing agents (1-5 mM DTT or TCEP)
4. Store at 4°C for short-term or flash-freeze for long-term storage
Loss of activity during storageFreeze-thaw damage, oxidation1. Avoid repeated freeze-thaw cycles
2. Aliquot before freezing
3. Include trehalose (6%) in storage buffer
4. Consider vacuum-sealing samples
Inconsistent functional assay resultsCo-factor loss, improper buffer conditions1. Supplement with potential cofactors (Fe, flavins)
2. Ensure proper pH for V. fischeri proteins (7.5-8.0)
3. Include appropriate salt concentrations (V. fischeri optimal: ~20 g/L NaCl)
4. Run parallel positive controls

Additionally, when working with RnfG protein in the context of electron transport studies, researchers should be aware that glycerol in growth media can cause acidification, potentially affecting experiment outcomes . To mitigate this issue, use properly buffered media and monitor pH throughout experiments involving metabolically active cells.

For successful reconstitution of recombinant RnfG after lyophilization, it's recommended to briefly centrifuge the vial before opening to bring contents to the bottom, and then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol added for stability .

How can researchers distinguish between specific effects of RnfG manipulation versus general disruption of electron transport in experimental studies?

Distinguishing between specific effects of RnfG manipulation and general disruption of electron transport requires a carefully designed experimental approach with appropriate controls and complementary methodologies:

By implementing this multi-faceted approach, researchers can confidently attribute observed phenotypes to RnfG-specific functions rather than general perturbations of electron transport, leading to more precise characterization of this protein's role in V. fischeri physiology.

What emerging techniques could advance our understanding of RnfG structure-function relationships?

Several cutting-edge methodological approaches are poised to significantly advance our understanding of RnfG structure-function relationships:

  • Cryo-electron microscopy for membrane protein complexes:

    • Recent advances in cryo-EM have revolutionized membrane protein structural biology

    • Single-particle analysis could reveal the complete structure of the Rnf complex including RnfG

    • Subtomogram averaging of the complex in membrane environments would provide native-state structural insights

    • Time-resolved cryo-EM could potentially capture conformational changes during electron transport

  • Integrative structural biology approaches:

    • Combining X-ray crystallography of individual domains with cryo-EM of the full complex

    • Supplementing with small-angle X-ray scattering (SAXS) for solution-state conformational information

    • Using hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map dynamic regions and interfaces

    • Computational modeling to integrate diverse structural data sets

  • Advanced spectroscopic techniques:

    • Electron paramagnetic resonance (EPR) spectroscopy to track electron movement through the complex

    • Time-resolved fluorescence energy transfer to monitor conformational dynamics

    • Solid-state NMR for atomic-level insights into membrane-embedded regions

    • Surface-enhanced Raman spectroscopy to probe cofactor interactions

  • In-cell structural biology:

    • Proximity labeling approaches (BioID, APEX) to map interaction networks in living cells

    • In-cell NMR to observe structural changes under physiological conditions

    • Correlative light and electron microscopy to connect structure with cellular localization

    • FRET sensors to monitor RnfG conformational changes during electron transport in vivo

  • AI-enhanced structural prediction and analysis:

    • AlphaFold2 and RoseTTAFold for accurate prediction of RnfG structure

    • Machine learning approaches to predict functional sites based on evolutionary conservation

    • Molecular dynamics simulations guided by AI to model electron transfer pathways

    • Graph neural networks to predict effects of mutations on structure and function

These methodologies, particularly when used in combination, offer unprecedented potential to elucidate how the structure of RnfG relates to its function in electron transport, potentially revealing novel mechanisms of energy conservation in bacterial respiratory systems.

How might comparative studies of RnfG across different bacterial species inform our understanding of electron transport evolution?

Comparative studies of RnfG across diverse bacterial species offer a powerful approach to understanding electron transport evolution, potentially revealing how this critical component has adapted to different ecological niches and metabolic strategies:

  • Phylogenetic analysis and molecular evolution:

    • Construction of comprehensive RnfG phylogenies across the bacterial domain

    • Calculation of selection pressures (dN/dS ratios) to identify conserved functional domains versus rapidly evolving regions

    • Ancestral sequence reconstruction to trace the evolutionary trajectory of RnfG

    • Correlation of RnfG sequence variations with bacterial lifestyle (free-living, symbiotic, pathogenic)

  • Structural comparisons across diverse bacteria:

    • Comparing RnfG structures from model organisms like V. fischeri with those from:
      a) Other marine bacteria with different symbiotic relationships
      b) Extremophiles adapting to challenging energy environments
      c) Anaerobic bacteria using alternative electron acceptors
      d) Pathogens that have optimized energy efficiency for host colonization

    • These comparisons would highlight structural adaptations linked to specific ecological challenges

  • Functional heterologous expression studies:

    • Expressing RnfG proteins from diverse bacteria in a model system (e.g., V. fischeri rnfG deletion mutant)

    • Measuring complementation efficiency across varying environmental conditions

    • Creating chimeric RnfG proteins to map functional domains

    • This approach has successfully identified adaptive signatures in other ETS components

  • Correlation with respiratory versatility:

    • Analyzing RnfG sequence features in relation to bacterial respiratory capabilities:

    Bacterial GroupRnfG FeatureRespiratory CapabilityEcological Niche
    Obligate aerobes[To be determined]Strictly oxygen-dependentOxygen-rich environments
    Facultative anaerobes[To be determined]Multiple terminal electron acceptorsFluctuating oxygen conditions
    Anaerobes[To be determined]Alternative electron transport chainsAnoxic environments
    Phototrophs[To be determined]Light-driven electron transportLight-exposed habitats
  • Systems biology comparative approach:

    • Integration of RnfG sequence/structure data with:
      a) Whole-genome information on respiratory pathways
      b) Metabolic network architecture across species
      c) Transcriptional regulation patterns of energy metabolism
      d) Proteome allocation strategies

    • This would reveal how RnfG evolution is constrained by or drives broader adaptations in energy metabolism

Such comparative studies would not only illuminate the evolutionary history of RnfG but would also provide insights into how bacteria adapt their electron transport systems to diverse ecological challenges. This knowledge could potentially inform synthetic biology approaches to engineer electron transport systems with desired properties for biotechnological applications.

How can systems biology approaches integrate RnfG function into comprehensive models of bacterial energy metabolism?

Systems biology offers powerful frameworks to integrate RnfG function into holistic models of bacterial energy metabolism, providing deeper insights than isolated protein studies. The following approaches represent cutting-edge methods for this integration:

These systems biology approaches would transform our understanding of RnfG from an isolated protein component to an integrated element in the complex network of bacterial energy metabolism, providing predictive frameworks for hypothesis generation and experimental design. The resulting models could have applications in synthetic biology, metabolic engineering, and potentially in understanding energy metabolism in related pathogenic Vibrio species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.