Recombinant Vibrio fischeri Fumarate reductase subunit C (frdC)

What is the structural and functional role of frdC in Vibrio fischeri?

Fumarate reductase subunit C (frdC) in Vibrio fischeri is primarily involved in anchoring the catalytic components of the fumarate reductase complex to the cytoplasmic membrane. As a membrane protein of 127 amino acids with a molecular mass of approximately 14.3 kDa, frdC belongs to the FrdC protein family and contains predominantly hydrophobic residues that facilitate membrane integration. The protein sequence (MSNRKPYVREMTRTWWKDHPFYRFYMVREATVLPLIFFTICLLVGLGSLVKGPLAWASWLDFMANPIVVALNIVALAGSLFHAQTFFSMMPQVMPIRLGGKTLDKKVVVLAQWAAVAAITLLVLVIV) contains multiple transmembrane regions essential for proper orientation within the lipid bilayer . The anchoring function is critical for maintaining the proper spatial organization of the entire fumarate reductase complex, which plays a significant role in anaerobic respiration pathways.

How does frdC contribute to the metabolic versatility of Vibrio fischeri?

The frdC protein contributes significantly to V. fischeri's metabolic flexibility, especially during transitions between aerobic and anaerobic environments. Methodologically, researchers can assess this by comparing growth rates and metabolite profiles of wild-type versus frdC-deficient strains under various oxygen tensions. The fumarate reductase complex, of which frdC is an essential component, enables V. fischeri to use fumarate as a terminal electron acceptor during anaerobic respiration. This capability is particularly relevant during host colonization when oxygen availability fluctuates. Genome-scale modeling approaches have demonstrated that this metabolic versatility contributes to V. fischeri's successful colonization of the squid host . Studies should incorporate measurements of redox potential, ATP production, and growth yields under varying oxygen conditions to fully characterize the metabolic impact of frdC function.

What distinguishes Vibrio fischeri frdC from homologous proteins in other bacterial species?

When examining the evolutionary distinctiveness of V. fischeri frdC, researchers should employ comparative genomic and structural analysis methodologies. Sequence alignment studies with homologous proteins from related species reveal that while the core functional domains are conserved, V. fischeri frdC contains unique amino acid substitutions that may reflect adaptation to its symbiotic lifestyle. These differences can be identified through multiple sequence alignment followed by determination of residue conservation scores and identification of species-specific variations. Functional differences can be assessed through heterologous expression experiments, where frdC from different species is expressed in a common host strain, followed by membrane integration efficiency analysis and fumarate reductase activity measurements. Vibrio fischeri frdC appears specially adapted for functioning at the cooler temperatures associated with its squid host habitat, as indicated by genome-scale modeling studies suggesting optimal activity at approximately 28°C .

What are the optimal expression systems for producing recombinant V. fischeri frdC?

For successful expression of recombinant V. fischeri frdC, researchers should consider both prokaryotic and eukaryotic expression systems based on experimental objectives. For structural studies requiring high protein yields, E. coli-based expression using pET vectors with an N-terminal His-tag shows good results. The methodology should incorporate the following key elements: (1) codon optimization for the expression host, (2) temperature reduction to 18-20°C during induction to facilitate proper membrane protein folding, (3) use of mild detergents such as n-dodecyl β-D-maltoside (DDM) for extraction, and (4) incorporation of stabilizing agents during purification. For functional studies, expression in closely related Vibrio species may provide a more native-like membrane environment. Recent advances in cell-free expression systems also offer advantages for membrane protein production, allowing direct incorporation into nanodiscs or liposomes. Based on commercial protein synthesis services, the relatively small size of frdC (127 amino acids) makes it amenable to cost-effective recombinant production .

How can researchers optimize purification protocols for recombinant frdC?

Purification of membrane proteins like frdC requires specialized methodologies to maintain structural integrity and function. A robust purification protocol should begin with efficient membrane fraction isolation using ultracentrifugation (typically 100,000 × g for 1 hour). For solubilization, screen multiple detergents at various concentrations; DDM (1%), LDAO (0.5%), and CHAPS (0.5-1%) have shown success with similar membrane proteins. Purification should employ a multi-step approach: (1) immobilized metal affinity chromatography (IMAC) using nickel or cobalt resins with gradual imidazole elution (50-300 mM), (2) size exclusion chromatography to remove aggregates and achieve higher purity, and (3) optional ion exchange chromatography for removing contaminants with different charge properties. Throughout purification, maintain stabilizing agents such as glycerol (10%) and avoid extreme pH conditions. For quality control, researchers should perform SDS-PAGE analysis, mass spectrometry verification, and circular dichroism to assess secondary structure integrity. For functional studies, reconstitution into liposomes or nanodiscs may be necessary to evaluate membrane anchoring properties.

What analytical techniques are most informative for studying frdC interaction with other fumarate reductase subunits?

Investigating the interactions between frdC and other fumarate reductase subunits requires a combination of biochemical, biophysical, and structural approaches. Cross-linking studies using bifunctional reagents followed by mass spectrometry analysis can identify interaction sites. Co-immunoprecipitation experiments with tagged proteins provide evidence of complex formation. For more detailed characterization, researchers should consider:

• Förster Resonance Energy Transfer (FRET) analysis using fluorescently labeled proteins to measure interaction distances

• Surface Plasmon Resonance (SPR) to determine binding kinetics

• Isothermal Titration Calorimetry (ITC) for thermodynamic parameters of binding

For structural studies, cryo-electron microscopy has proven effective for membrane protein complexes. Additionally, native mass spectrometry can reveal the stoichiometry of the complete complex. Functional reconstitution assays where purified components are mixed in defined ratios to restore enzymatic activity provide critical insights into the requirements for proper complex assembly. When analyzing data, researchers should be mindful that detergent choice can significantly affect observed interaction properties.

How is frdC expression regulated during host colonization by V. fischeri?

Transcriptional regulation of frdC during host colonization involves complex responses to environmental cues. RNA-Seq data from host-associated V. fischeri cells provides critical insights into these regulatory patterns . Methodologically, researchers should design experiments comparing gene expression between planktonic cultures and symbiont populations isolated from juvenile E. scolopes squids at different colonization stages. Differential expression analysis techniques, including DESeq2 or edgeR, can identify statistically significant changes.

Current data indicates that frdC expression patterns correlate with shifts in central metabolism during host association. This regulation appears to be part of a larger metabolic reconfiguration involving TCA cycle interruption, as evidenced by the downregulation of multiple succinate-related genes (sucA, sucB, sucC, sucD) during colonization . The regulatory network likely involves the pirin protein (VF_1068), which shows significant upregulation (log2 fold change of 3.5) during host association and may function as a respiration/fermentation switch regulator .

To fully elucidate regulatory mechanisms, researchers should perform chromatin immunoprecipitation followed by sequencing (ChIP-seq) to identify transcription factor binding sites in the frdC promoter region. Reporter fusion assays using frdC promoter constructs can validate these findings in vivo under different environmental conditions.

What role does frdC play in the metabolic adaptation of V. fischeri to microaerobic environments?

The frdC protein plays a crucial role in adapting V. fischeri metabolism to microaerobic conditions, particularly during host colonization. Research methodologies should include comparative growth studies under varying oxygen tensions, metabolic flux analysis, and respirometry measurements. Under oxygen limitation, the fumarate reductase complex becomes essential for maintaining redox balance by allowing fumarate to serve as an alternative electron acceptor.

Genome-scale modeling approaches have demonstrated that this metabolic flexibility contributes significantly to V. fischeri's ability to thrive in the dynamic oxygen environment of the squid light organ . The interruption of the TCA cycle observed in transcriptional data (with downregulation of acnB by log2 fold change of -1.7) suggests a metabolic reconfiguration where the fumarate reductase complex may play an increasingly important role .

To quantitatively assess the contribution of frdC to microaerobic adaptation, researchers should employ isotope-labeled substrate tracing experiments to track metabolic flux through alternative pathways. Additionally, membrane potential measurements in wild-type versus frdC-deficient strains can reveal the energetic consequences of this metabolic adaptation.

How does temperature affect frdC function and expression in V. fischeri?

Temperature significantly influences both frdC expression and function in V. fischeri, with important implications for symbiotic competence. Research methodologies should include qRT-PCR analysis of frdC expression across a temperature gradient (15-37°C), enzymatic activity assays of the fumarate reductase complex at different temperatures, and thermal stability assessments of the purified protein.

For comprehensive characterization, researchers should perform thermal shift assays to determine the melting temperature of the protein, differential scanning calorimetry to assess thermodynamic parameters, and circular dichroism spectroscopy to monitor temperature-induced conformational changes. Additionally, lipid composition analysis of the bacterial membrane at different temperatures can provide insights into adaptations that maintain proper frdC function across the physiologically relevant temperature range.

How can genome-scale metabolic modeling enhance our understanding of frdC function in V. fischeri?

Genome-scale metabolic modeling provides powerful frameworks for investigating frdC function within the broader metabolic network of V. fischeri. Researchers should employ established models such as iVF846, which was developed specifically for V. fischeri ES114 and can be compared with E. coli models like iJO1366 . Methodologically, this approach involves:

• Constraint-based modeling techniques such as Flux Balance Analysis (FBA) to predict metabolic fluxes

• Gene essentiality simulations through in silico gene knockouts

• Integration of transcriptomic data to create context-specific models

• Sensitivity analysis to identify conditions where frdC function becomes critical

These computational approaches have revealed that bioluminescence represents a significant energy cost to V. fischeri, particularly under limited oxygen conditions, which may influence the relative importance of alternative respiratory pathways involving fumarate reductase . When interpreting model predictions, researchers should validate key findings experimentally through targeted gene deletions and metabolic flux measurements using 13C-labeled substrates.

For advanced applications, researchers can extend these models to simulate host-microbe interactions by integrating host metabolism, or to investigate metabolic adaptations across different V. fischeri strains with varying colonization phenotypes ("dominant" vs. "sharing") .

What structural features of frdC contribute to its membrane anchoring properties?

Understanding the structural determinants of frdC membrane anchoring requires integrated computational and experimental approaches. Researchers should begin with hydropathy analysis and transmembrane domain prediction using algorithms such as TMHMM, MEMSAT, and OCTOPUS. Molecular dynamics simulations can then model protein-lipid interactions in atomistic detail.

Experimentally, site-directed mutagenesis of predicted membrane-interacting residues followed by localization studies can validate computational predictions. Techniques for assessing membrane integration include:

• Fluorescence microscopy using GFP-fusion constructs

• Membrane fractionation followed by Western blotting

• Protease protection assays to determine topology

• Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling

Based on the amino acid sequence (MSNRKPYVREMTRTWWKDHPFYRFYMVREATVLPLIFFTICLLVGLGSLVKGPLAWASWLDFMANPIVVALNIVALAGSLFHAQTFFSMMPQVMPIRLGGKTLDKKVVVLAQWAAVAAITLLVLVIV), frdC likely contains multiple hydrophobic transmembrane segments that anchor the protein within the cytoplasmic membrane . The distribution of charged residues (particularly lysines and arginines) at predicted membrane-water interfaces likely contributes to proper orientation following the "positive-inside" rule of membrane protein topology.

How does frdC function relate to the bioluminescence phenotype in V. fischeri?

Investigating the relationship between frdC function and bioluminescence requires integrated approaches spanning genetics, biochemistry, and systems biology. Genome-scale modeling has demonstrated that bioluminescence represents a significant energy drain for V. fischeri, particularly under oxygen-limited conditions . Since the fumarate reductase complex (including frdC) plays a key role in energy conservation during anaerobic respiration, there may be important metabolic trade-offs between these processes.

Research methodologies should include:

• Construction of frdC deletion and overexpression strains followed by quantitative luminescence measurements

• Metabolic flux analysis using 13C-labeled substrates to track carbon allocation between bioluminescence and respiratory pathways

• Real-time monitoring of oxygen consumption, bioluminescence, and fumarate reduction in controlled bioreactor conditions

• Transcriptional correlation analysis between frdC and luciferase genes under varying environmental conditions

Data analysis should employ multivariate statistical methods to identify significant correlations and potential regulatory connections. Current evidence suggests that metabolic reconfiguration during host colonization, which includes changes in TCA cycle gene expression , may create conditions where both bioluminescence and fumarate reductase activity become important for bacterial fitness.

How can researchers address protein aggregation issues when working with recombinant frdC?

Membrane proteins like frdC are prone to aggregation during expression and purification. A systematic troubleshooting approach involves:

• Expression optimization: Reduce expression temperature to 16-20°C, decrease inducer concentration, and consider specialized E. coli strains designed for membrane protein expression (C41(DE3), C43(DE3), or Lemo21(DE3)).

• Solubilization strategies: Screen a panel of detergents at varying concentrations, including:

  • Mild detergents: DDM (0.5-1%), LMNG (0.01-0.05%), DMNG (0.05-0.1%)

  • Zwitterionic detergents: LDAO (0.1-0.5%), CHAPS (0.5-2%)

  • Mixed micelle systems: Combination of primary detergent with cholesterol hemisuccinate

• Buffer optimization: Include stabilizing additives such as glycerol (10-20%), specific lipids (POPE, POPG), and osmolytes (trehalose, sucrose).

• Purification considerations: Use gradient elution during chromatography steps, maintain detergent above critical micelle concentration throughout all steps, and consider on-column detergent exchange.

• Quality assessment: Employ analytical size exclusion chromatography, dynamic light scattering, and negative-stain electron microscopy to differentiate between monomeric protein, physiological oligomers, and non-specific aggregates.

For particularly challenging cases, consider fusion partners that enhance solubility (SUMO, MBP) or novel membrane mimetics such as nanodiscs, SMALPs (styrene-maleic acid lipid particles), or amphipols as alternatives to conventional detergents.

What controls and validation steps are essential when studying frdC interactions with other fumarate reductase subunits?

When investigating protein-protein interactions involving frdC, rigorous controls and validation steps are essential to ensure reliable results. A comprehensive experimental design should include:

• Negative interaction controls:

  • Empty vector/tag-only controls to identify false positives from tag interactions

  • Unrelated membrane proteins of similar size/topology to control for non-specific hydrophobic interactions

  • Heat-denatured protein samples to distinguish between specific and non-specific binding

• Positive interaction controls:

  • Known interacting protein pairs from related bacterial species

  • Artificially designed constructs with confirmed binding domains

• Validation through orthogonal methods:

  • Confirm interactions detected by co-immunoprecipitation using reverse pull-down experiments

  • Validate in vitro interactions with in vivo approaches (bacterial two-hybrid, FRET in living cells)

  • Correlate binding studies with functional activity assays

• Quantitative analysis:

  • Determine binding stoichiometry through analytical ultracentrifugation or size exclusion chromatography-multiple angle light scattering (SEC-MALS)

  • Measure binding affinities using microscale thermophoresis or isothermal titration calorimetry

  • Assess kinetic parameters with surface plasmon resonance

• Structural validation:

  • Perform cross-linking mass spectrometry to identify interaction interfaces

  • Use hydrogen-deuterium exchange mass spectrometry to map conformational changes upon complex formation

Proper statistical analysis, including technical and biological replicates with appropriate significance testing, is essential for meaningful interpretation of interaction data.

How can researchers distinguish between phenotypes caused by frdC disruption versus polar effects on adjacent genes?

Distinguishing direct effects of frdC disruption from polar effects on adjacent genes requires sophisticated genetic approaches. Methodologically, researchers should:

• Construct multiple mutant strains using different strategies:

  • In-frame deletion mutants that minimize disruption of adjacent gene expression

  • Point mutations that affect specific functional residues without altering transcript levels

  • Conditional expression systems where frdC can be depleted post-transcriptionally

• Perform comprehensive transcriptional analysis:

  • RT-qPCR to measure expression of genes in the frd operon and adjacent regions

  • RNA-Seq to assess genome-wide transcriptional changes

  • 5' RACE to identify potential alternative transcription start sites

• Implement complementation strategies:

  • Trans-complementation with frdC alone under control of an inducible promoter

  • Cis-complementation by restoring the wild-type sequence at the native locus

  • Heterologous complementation with frdC orthologs from related species

• Utilize advanced genetic tools:

  • CRISPR interference (CRISPRi) for targeted transcriptional repression

  • Translational fusion reporters to monitor protein levels independently of transcription

  • Allelic exchange techniques that preserve operon structure

Data analysis should include correlation testing between frdC expression levels and observed phenotypes across multiple genetic constructs. When interpreting results, researchers should consider the genomic context of frdC and its potential involvement in multienzyme complexes like the fumarate reductase system.