Recombinant Vibrio fischeri Fumarate reductase subunit D (frdD)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs unless dry ice shipping is specifically requested and arranged in advance; additional fees apply.
Note: Products are shipped with standard blue ice packs unless dry ice shipping is specifically requested and arranged in advance; additional fees apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
frdD; VFMJ11_2459; Fumarate reductase subunit D; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Vibrio fischeri (strain MJ11)
Target Names
frdD
Target Protein Sequence
MVNRNPKRSDEPVWWGLFGAGGTWFAMLTPVTILVLGILVPLGVIGPESMNYLRVAGFVT
SIIGALFVIGSISMPMWHAMHRLHHGMHDLKFHTGTAGKIACYAAAALATVLSVVFIFMI
Uniprot No.
Target Background
Function
Anchors the catalytic components of the fumarate reductase complex to the cell membrane and binds quinones.
Database Links
KEGG: vfm:VFMJ11_2459
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
