Recombinant Vibrio fischeri Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare according to your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
msbA; VF_A0424; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-582
Protein Length
full length protein
Species
Vibrio fischeri (strain ATCC 700601 / ES114)
Target Names
msbA
Target Protein Sequence
MTIEKDESTWATFKRLWPHISLYKAGLGVAVVALVINALSDTYMISLLKPLLDEGFGSAD SDFLKKMPFIILAMMFIRGLSGFVSGYCMSWVASNVVMRIRRQIFNHFMHMPVSYFDQES TGRLLSRITYDSEQVAAATSKALVNIVRESASIIGLLGLMFWNSWQLSLVLVVIAPVVAF AISNVSKRFRKISKNMQTAMGSLTATSEQMLKGHKVVLSYGGQKVESERFDNISNHMRQQ NMKMVVAQGLANPIIQMIASFALVTVLYLASVDSIKETLTPGTFTVVFSAMFGLLRPLKG LTSVTSDFQRGMAACQTLFELMDMDKEKDDGTIEKDTVKGDIKVDNVTFTYPTADGPALR NVSFDLPAGKTIALVGRSGSGKSTIANLFTRFYDVDSGEISLDGDKIEDYRLPNLRKHFA LVSQNVHLFNDTVANNIAYASEGKFTRLEIEKAAELAYASDFINKMDDGFDTMIGENGAS LSGGQRQRIAIARALLQNAPVLILDEATSALDTESEKAIQSALDELQKDKTVLVIAHRLS TIEDADQILVVDEGEVVERGNHAELIAHDGAYAQLHRIQFGD
Uniprot No.

Target Background

Function
This protein is involved in lipopolysaccharide (LPS) biosynthesis. It translocates lipid A-core from the inner leaflet to the outer leaflet of the inner membrane. Transmembrane domains (TMD) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Structure and Function of Vibrio fischeri MsbA

  • What is the basic structure and function of MsbA in Vibrio fischeri?

    MsbA is a 65 kDa membrane protein that functions as a homodimeric ATP-dependent lipid translocase or flippase. In Gram-negative bacteria like Vibrio fischeri, it plays an essential role in transporting lipid A from the inner to the outer leaflet of the cytoplasmic membrane . The protein contains characteristic ATP-binding cassette (ABC) domains that provide the energy for lipid translocation through ATP hydrolysis. The full-length protein typically consists of 583 amino acids, as seen in homologous proteins from related species . MsbA's structure includes transmembrane domains that anchor it in the bacterial membrane and nucleotide-binding domains that interact with ATP and ADP during the transport cycle.

  • How does MsbA contribute to LPS biogenesis in Vibrio fischeri?

    MsbA plays a pivotal role in lipopolysaccharide (LPS) biogenesis by facilitating the transport of lipid A components across the bacterial membrane . As a critical component of the outer membrane in Gram-negative bacteria, LPS contributes to structural integrity and serves as a barrier against environmental stresses. In Vibrio fischeri, which engages in symbiotic relationships with hosts like the Hawaiian squid Euprymna scolopes, proper LPS biogenesis is essential for colonization and interaction with host tissues . The lipid A component, which MsbA transports, forms the anchor of LPS and is important for bacterial survival and host interactions. Defects in MsbA function would impair LPS assembly and potentially affect the bacterium's ability to establish symbiotic relationships.

  • What lipid substrates does MsbA transport?

    Research has demonstrated that purified and functionally active MsbA reconstituted into proteoliposomes possesses flippase activity for a diverse range of lipid species. These include both headgroup- and acyl chain-labeled derivatives of phospholipids such as phosphatidylethanolamine (PE) and phosphatidylserine (PS), as well as chain-labeled phosphatidylglycerol (PG), phosphatidylcholine (PC), and sphingomyelin (SM) . This broad substrate specificity indicates MsbA's versatility in membrane lipid organization. The protein demonstrates the highest rates of flippase activity when reconstituted into a native E. coli lipid mixture, suggesting optimal function in its natural lipid environment .

Experimental Approaches for MsbA Research

  • What are the optimal conditions for expressing and purifying recombinant Vibrio fischeri MsbA?

    For successful expression and purification of recombinant MsbA, E. coli is typically used as the expression system . The protein should be fused to an affinity tag, such as an N-terminal His-tag, to facilitate purification. After expression, the protein can be extracted from bacterial membranes using appropriate detergents, followed by affinity chromatography to isolate the tagged protein. For storage, recombinant MsbA is best maintained as a lyophilized powder or in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 . The purified protein should be stored at -20°C/-80°C, with aliquoting necessary to avoid repeated freeze-thaw cycles. When reconstituting the protein, it's recommended to use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added as a cryoprotectant for long-term storage .

  • How can the ATPase activity of recombinant MsbA be measured?

    The ATPase activity of MsbA can be monitored through several complementary approaches. One effective method involves native mass spectrometry to track the binding and turnover of ATP and the subsequent appearance of ADP. This technique allows researchers to observe the various molecular states of MsbA during its catalytic cycle, including the binding of specific numbers of ATP and ADP molecules . Time-course experiments can reveal how MsbA converts ATP to ADP over extended periods (e.g., 10 hours with measurements at 2-hour intervals). Additionally, the influence of different lipids on ATPase activity can be assessed by including specific lipid species in the reaction mixture. For instance, research has shown that the presence of lipids like TOCDL and KDL modulates the ATP binding and hydrolysis patterns of MsbA .

  • What reconstitution methods are most effective for studying MsbA's lipid translocation activity?

    To study MsbA's lipid translocation activity, the protein should be reconstituted into proteoliposomes composed of phospholipids. The most effective approach involves:

    1. Purifying MsbA to high homogeneity (>90% as determined by SDS-PAGE)

    2. Preparing liposomes from a lipid mixture, preferably E. coli lipids for optimal activity

    3. Incorporating fluorescently labeled lipids (such as NBD-labeled derivatives) into the liposomes

    4. Reconstituting purified MsbA into these liposomes using detergent removal techniques

    5. Measuring ATP-dependent translocation of the fluorescent lipids using appropriate fluorescence assays

    Research has shown that MsbA demonstrates the highest rates of flippase activity when reconstituted into an E. coli lipid mixture compared to other lipid compositions . This methodology allows for quantitative assessment of MsbA's ability to translocate various lipid species across the membrane bilayer in an ATP-dependent manner.

MsbA in Vibrio fischeri Biology and Symbiosis

  • How does MsbA function contribute to Vibrio fischeri's symbiotic relationship with marine hosts?

    In Vibrio fischeri, MsbA's role in lipopolysaccharide (LPS) biogenesis has important implications for the bacterium's symbiotic relationship with marine hosts like the Hawaiian squid Euprymna scolopes. The symbiosis between V. fischeri and E. scolopes serves as a model system for studying beneficial host-bacteria interactions . Proper LPS structure, facilitated by MsbA transport function, is critical for several aspects of this symbiotic relationship:

    First, LPS components play signaling roles during the initial colonization process. The lipid A portion of LPS, which MsbA transports, can interact with host receptors and influence colonization dynamics. Research has shown that secondary acylations of lipid A may be important during initial infection, as demonstrated by delayed colonization in mutants with altered lipid A acyltransferase activity .

    Second, LPS integrity affects the bacterium's ability to withstand host immune defenses. As V. fischeri colonizes the squid's light organ, it must survive various antimicrobial factors produced by the host. Properly structured LPS provides protection against these defenses.

    Finally, LPS components released during bacterial growth can serve as microbe-associated molecular patterns (MAMPs) that stimulate normal development of the host's light organ. For example, peptidoglycan monomers released by V. fischeri have been shown to induce regression of ciliated appendages that initially promote bacterial colonization .

  • What methods can be used to study MsbA's role in Vibrio fischeri bioluminescence?

    Vibrio fischeri's bioluminescence is a key feature of its symbiotic relationship with marine hosts, and MsbA's role in membrane composition and integrity may indirectly influence this process. Several methods can be employed to investigate this relationship:

    1. Genetic manipulation approaches: Generating targeted mutations in the msbA gene or using controlled expression systems to modulate MsbA levels can help assess its impact on bioluminescence. This could involve creating knockout mutants, point mutations affecting specific functional domains, or inducible expression constructs.

    2. Real-time bioluminescence monitoring: V. fischeri's natural luminescence serves as a powerful bioreporter for real-time and label-free monitoring of cell physiology . Bioluminescence assays can be performed by measuring the 490-nm emission from bacterial suspensions at short time intervals (e.g., 100-ms intervals) to detect rapid changes in light output in response to experimental manipulations of MsbA function.

    3. Membrane composition analysis: Since MsbA affects membrane lipid organization, techniques like mass spectrometry and thin-layer chromatography can be used to analyze membrane lipid profiles in wild-type versus MsbA-modified strains, potentially revealing correlations between specific lipid distributions and bioluminescence capacity.

    4. Physiological stress response: The bioluminescence of V. fischeri responds quickly to environmental changes , making it a sensitive indicator of bacterial physiology. Exposing bacteria with altered MsbA function to various stressors and monitoring changes in light output could provide insights into how membrane integrity influences stress responses and bioluminescence regulation.

  • How do environmental factors affect MsbA expression and function in Vibrio fischeri?

    Environmental factors can significantly influence MsbA expression and function in Vibrio fischeri, particularly in the context of its symbiotic lifestyle. Several key environmental parameters and their effects include:

    1. Divalent cation availability: Magnesium (Mg) and calcium (Ca) ions have been shown to affect various cellular processes in V. fischeri, including motility and cyclic-di-GMP (c-di-GMP) levels . While specific effects on MsbA have not been directly demonstrated, these ions likely influence membrane properties and could modulate MsbA function. Research has shown that Mg negatively affects c-di-GMP levels while Ca positively affects them, with corresponding impacts on bacterial migration .

    2. Temperature fluctuations: As a marine bacterium that transitions between free-living and host-associated states, V. fischeri experiences temperature variations that could affect MsbA expression and activity. Temperature changes are known to alter membrane fluidity, which directly impacts membrane protein function.

    3. Osmotic conditions: Salinity changes in marine environments can affect membrane integrity and composition. MsbA's role in maintaining proper membrane organization may become particularly important under osmotic stress conditions.

    4. Microwave electromagnetic fields: Interestingly, research has shown that V. fischeri responds rapidly to microwave electric field exposure, with measurable changes in bioluminescence occurring within 100-ms of exposure . While direct effects on MsbA were not investigated, such electromagnetic fields likely influence membrane properties and could affect MsbA's lipid translocation function.

    Investigating these environmental factors' effects on MsbA could involve gene expression analysis under varying conditions, functional assays of lipid translocation activity in different environments, and studying how membrane composition changes in response to environmental stimuli.

Comparative Analysis and Research Applications

  • How does Vibrio fischeri MsbA compare structurally and functionally to MsbA from other bacterial species?

    Comparative analysis of MsbA from Vibrio fischeri and other bacterial species reveals both conservation and divergence in structure and function. While comprehensive structural data on V. fischeri MsbA specifically is limited in the provided research materials, we can make informed comparisons based on available information:

    Structurally, MsbA maintains key domains across bacterial species, including the characteristic ATP-binding cassette (ABC) domains and transmembrane segments. The full-length protein typically consists of approximately 583 amino acids, as observed in homologous proteins from related species . Sequence analysis would likely reveal conserved motifs essential for ATP binding and hydrolysis, such as the Walker A and B motifs and the signature sequence typical of ABC transporters.

    Functionally, MsbA serves as a lipid flippase across bacterial species, though substrate preferences may vary. In Escherichia coli, MsbA has been shown to transport various fluorescently labeled lipid species, including derivatives of PE, PS, PG, PC, and SM . While specific substrate profiles for V. fischeri MsbA have not been detailed in the provided materials, its fundamental role in lipid A transport is likely conserved given the essential nature of this function in Gram-negative bacteria.

    A notable aspect of MsbA function across species is its interaction with lipids that modulate ATP binding and hydrolysis. Studies have demonstrated that different lipid species can affect nucleotide binding patterns in MsbA, with lipids like KDL enhancing ATP binding particularly when multiple lipid molecules are associated with the protein . These lipid-dependent effects on MsbA activity likely represent conserved regulatory mechanisms across bacterial species.

  • What insights can studies of recombinant MsbA provide for understanding bacterial antibiotic resistance?

    Studies of recombinant MsbA can provide valuable insights into bacterial antibiotic resistance mechanisms through several research avenues:

    First, MsbA's role in lipopolysaccharide (LPS) transport directly impacts outer membrane integrity in Gram-negative bacteria. The outer membrane serves as a crucial permeability barrier against many antibiotics, and alterations in LPS composition or distribution due to MsbA dysfunction could affect antibiotic penetration and efficacy. Research using recombinant MsbA can help elucidate how specific mutations or expression changes might contribute to modified outer membrane properties associated with antibiotic resistance.

    Second, as an ABC transporter, MsbA shares structural and functional similarities with multidrug efflux pumps that actively export antibiotics from bacterial cells. While MsbA's primary function involves lipid transport rather than drug efflux, studying its structural dynamics, ATP hydrolysis mechanism, and substrate recognition principles can provide models for understanding related transporters directly involved in antibiotic resistance.

    Third, recombinant MsbA serves as a valuable target for screening potential inhibitors that could synergize with existing antibiotics. Compounds that interfere with MsbA function would compromise outer membrane integrity, potentially increasing bacterial susceptibility to antibiotics that normally have limited efficacy against Gram-negative pathogens. The availability of purified, functional recombinant MsbA enables high-throughput screening approaches and detailed mechanistic studies of inhibitor binding and action.

  • What advanced structural biology techniques are most informative for studying recombinant MsbA protein interactions?

    Several advanced structural biology techniques provide complementary insights into recombinant MsbA protein interactions:

    1. Native Mass Spectrometry: This technique has proven particularly valuable for studying MsbA's interactions with nucleotides and lipids. It allows researchers to observe various molecular states during the protein's catalytic cycle, including specific stoichiometries of ATP, ADP, and lipid binding . Time-course experiments using native mass spectrometry can reveal how these binding events evolve during the transport cycle, providing dynamic information not accessible through static structural methods.

    2. Cryo-Electron Microscopy (Cryo-EM): While not explicitly mentioned in the provided search results, cryo-EM has revolutionized structural studies of membrane proteins like MsbA. This technique can reveal the protein's three-dimensional structure in different conformational states without the need for crystallization, potentially capturing intermediates in the transport cycle. High-resolution cryo-EM structures would illuminate how lipid and nucleotide binding induces conformational changes in MsbA.

    3. Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique can map changes in protein dynamics and solvent accessibility upon binding of lipids, nucleotides, or potential inhibitors. HDX-MS would be particularly informative for identifying regions of MsbA that undergo conformational changes during the transport cycle or in response to different lipid environments.

    4. Molecular Dynamics Simulations: Computational approaches can model how MsbA interacts with lipids and nucleotides in a membrane environment over time. These simulations, informed by experimental structural data, can provide atomic-level insights into transient interactions and conformational changes that may be difficult to capture experimentally.

    5. Single-Molecule Förster Resonance Energy Transfer (smFRET): This technique can track conformational changes in individual MsbA molecules in real-time, potentially revealing heterogeneity in the protein's behavior and capturing rare or transient states in the transport cycle.

    Combining these techniques would provide a comprehensive understanding of how MsbA interacts with its substrates and how these interactions drive the structural changes necessary for lipid translocation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.