Recombinant Vibrio fischeri Na (+)-translocating NADH-quinone reductase subunit E

Shipped with Ice Packs
In Stock

Description

Functional Role in Na+-NQR Activity

NqrE contributes to the enzyme’s primary function: coupling NADH oxidation to sodium pumping. Key mechanistic insights include:

  • Electron Transfer: Electrons from NADH are shuttled via FAD and a [2Fe-2S] cluster in NqrF (subunit F) to quinone, with conformational changes in NqrC (subunit C) modulating sodium release .

  • Sodium Translocation: NqrE and NqrD form a sodium-binding site, with mutagenesis studies showing conserved cysteine residues in these subunits are essential for enzyme stability and activity .

  • Redox Coupling: The redox state of the [2Fe-2S] cluster in NqrD/E regulates electron flow and sodium pumping efficiency .

3.2. Metabolic and Physiological Impact

  • In V. cholerae, Na+-NQR deletion strains show altered metabolite profiles, including upregulated lysine decarboxylase activity and disrupted purine metabolism .

  • The enzyme generates a sodium motive force (SMF) critical for motility, antibiotic resistance, and osmoregulation in pathogenic Vibrio species .

3.3. Recombinant Applications

  • Recombinant NqrE is used to study Na+-NQR assembly and mechanism. Its production in E. coli enables biochemical assays, antibody development, and structural analysis .

  • The enzyme’s role in bacterial energetics makes it a potential target for antimicrobial agents .

Comparative Analysis of Na+-NQR Subunits

SubunitFunctionCofactorsRole in Na+ Translocation
NqrANADH bindingNon-covalent FADStabilizes NADH interaction
NqrBSodium binding siteCovalent FMNDirects Na+ release
NqrE[2Fe-2S] cluster coordination with NqrD[2Fe-2S] clusterElectron transfer and stability

Significance and Future Directions

Recombinant NqrE facilitates mechanistic studies of Na+-NQR, a key respiratory enzyme in pathogenic Vibrio species. Its structural conservation across Vibrio spp. supports extrapolation of findings to related pathogens like V. cholerae. Future research may explore:

  • The precise role of NqrE’s [2Fe-2S] cluster in redox coupling.

  • Development of inhibitors targeting Na+-NQR for antimicrobial therapies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have a specific format preference, please include your request in the order notes. We will prepare the product according to your requirements.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life of the product depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of that specific tag.
Synonyms
nqrE; VFMJ11_0749; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Vibrio fischeri (strain MJ11)
Target Names
nqrE
Target Protein Sequence
MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGVAVVVVLTIAVPVNNLVY TYLLKENALVAGVDLTFLSFITFIGVIAALVQILEMILDRFFPPLYNALGIFLPLITVNC AIFGGVSFMVQRDYNFAESVVYGFGSGIGWMLAIVALAGIREKMKYSDVPPGLRGLGITF ITVGLMALGFMSFSGVQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two sequential reactions. These reactions are coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Na(+)-translocating NADH-quinone reductase complex in Vibrio fischeri?

The Na(+)-translocating NADH:quinone oxidoreductase (Na+-NQR) in Vibrio species is a respiratory complex consisting of six subunits (NqrA through NqrF). This enzyme complex functions as a primary sodium pump that couples the oxidation of NADH to the translocation of sodium ions across the bacterial membrane. The complex contains multiple flavin cofactors and an iron-sulfur cluster, with each subunit playing specific roles in electron transfer and ion translocation. In V. fischeri, this complex contributes to energy metabolism and membrane potential generation, which may influence various cellular processes including bioluminescence regulation .

What is the specific function of the NqrE subunit within the Na+-NQR complex?

NqrE functions as a critical membrane-embedded component of the Na+-NQR complex. Based on structural and functional analyses, NqrE (198 amino acids) contains multiple transmembrane domains that contribute to forming the sodium ion channel within the complex. While NqrE itself does not directly participate in electron transfer, it plays an essential structural role in the assembly of the complex and in the formation of the ion translocation pathway. Its membrane-spanning regions help create the appropriate environment for sodium ion movement across the membrane during the electron transfer process mediated by other subunits .

What expression systems are most effective for producing recombinant NqrE protein?

For research-grade recombinant NqrE production, Escherichia coli-based expression systems have proven most effective. Specifically, when expressing the full-length NqrE (amino acids 1-198), an E. coli host with an N-terminal His-tag fusion yields functional protein that can be purified to >90% homogeneity using affinity chromatography. The selection of appropriate expression vectors (typically pET-series for T7 RNA polymerase-based expression) coupled with optimization of induction conditions (IPTG concentration, temperature, and duration) significantly impacts yield and quality. For membrane proteins like NqrE, expression at lower temperatures (16-20°C) after induction often improves proper folding and reduces inclusion body formation .

Expression success can be monitored by SDS-PAGE and Western blotting using anti-His antibodies. Alternative approaches include using Vibrio species as expression hosts, which may provide a more native membrane environment for proper folding, though with typically lower yields compared to optimized E. coli systems.

What purification methods yield the highest purity and activity for recombinant NqrE?

A multi-step purification protocol optimized for membrane proteins yields the highest purity and activity for recombinant His-tagged NqrE:

  • Membrane Fraction Isolation: After cell lysis by sonication or pressure-based methods, differential centrifugation (typically 5,000g to remove debris followed by 100,000g to collect membranes) concentrates the membrane fraction containing overexpressed NqrE.

  • Detergent Solubilization: The membrane fraction should be solubilized using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at concentrations just above their critical micelle concentration.

  • Immobilized Metal Affinity Chromatography (IMAC): The solubilized protein is purified using Ni-NTA or Co-NTA resins with imidazole gradient elution, maintaining detergent above CMC in all buffers.

  • Size Exclusion Chromatography: A final polishing step using gel filtration removes aggregates and ensures homogeneity.

For functional studies, maintaining the protein in a lipid-like environment using nanodiscs or liposomes following purification preserves native-like activity. Purified NqrE should be stored with 5-50% glycerol at -80°C in aliquots to prevent freeze-thaw cycles .

How can researchers assess the functional integrity of purified recombinant NqrE?

Assessing functional integrity of purified recombinant NqrE requires multiple complementary approaches:

Unlike the catalytically active NqrF subunit, which shows measurable NADH oxidation activity (approximately 20,000 μmol min-1 mg-1), NqrE does not possess intrinsic enzymatic activity that can be directly measured, making functional assessment more challenging and dependent on its correct integration into the complete complex .

What are the key structural domains and motifs in NqrE that are critical for its function?

NqrE (198 amino acids) contains several critical structural elements essential for its function:

  • Transmembrane Helices: NqrE contains multiple transmembrane domains (approximately 3-4 membrane-spanning alpha helices) that anchor the protein within the bacterial membrane. These hydrophobic segments can be identified in the amino acid sequence: residues approximately at positions 10-30, 60-80, 100-120, and 140-160.

  • Charged Residues in Transmembrane Domains: Specific charged amino acids (particularly aspartate and glutamate residues) within or adjacent to transmembrane segments are thought to participate in forming the sodium ion pathway.

  • Conserved Motifs: Sequence analysis reveals conserved motifs across Vibrio species, including:

    • A conserved glycine-rich motif near the N-terminus contributing to membrane insertion

    • A conserved charged residue pattern that likely forms part of the ion channel

  • Protein-Protein Interaction Regions: Specific regions mediate interactions with other Nqr subunits, particularly NqrB, NqrD, and NqrF, creating the functional complex .

Mutation studies targeting these domains can drastically impair sodium translocation without affecting complex assembly, indicating their direct role in the ion transport mechanism.

How does the amino acid sequence of V. fischeri NqrE compare to homologs in other bacterial species?

Comparative sequence analysis of NqrE across bacterial species reveals:

SpeciesSequence Identity (%)Sequence Similarity (%)Notable Differences
V. fischeri100 (reference)100 (reference)-
V. cholerae~70-75~85-90More charged residues in transmembrane regions
V. alginolyticus~65-70~80-85Extended C-terminal domain
V. harveyi~68-72~82-88Conservation in all transmembrane domains
E. coliNot presentNot presentNa+-NQR absent; uses NDH-1 instead

The sequence divergence primarily occurs in loop regions connecting the transmembrane helices, while the membrane-spanning segments show higher conservation. This pattern suggests evolutionary pressure to maintain the core structural elements involved in sodium translocation. Multiple sequence alignments reveal that residues involved in subunit interactions and ion channeling are the most highly conserved, particularly those forming the sodium pathway. These comparisons have helped identify functionally critical residues that remain invariant across the Vibrio genus .

What is known about the interaction between NqrE and other subunits in the Na+-NQR complex?

The assembly of the Na+-NQR complex involves specific interactions between NqrE and other subunits:

  • NqrB and NqrD Interactions: NqrE forms strong associations with these subunits to create the membrane-embedded portion of the complex. Cross-linking studies coupled with mass spectrometry have identified specific residues at the interfaces between these proteins.

  • NqrC Proximity: Though not directly interacting with NqrE, NqrC associates with the membrane domain and transfers electrons to the quinone reduction site near the NqrE-NqrD-NqrB interface.

  • NqrF Interface: While NqrF contains the NADH binding and oxidation site, it connects to the membrane domain partially through interactions with NqrE. The electron transfer from FAD to the Fe-S cluster in NqrF eventually leads to electron movement toward the membrane domain containing NqrE.

  • Stoichiometry: Within the functional complex, there is a 1:1:1:1:1:1 ratio of subunits NqrA:NqrB:NqrC:NqrD:NqrE:NqrF.

Research using protein-protein interaction techniques (bacterial two-hybrid systems, co-immunoprecipitation) has demonstrated that NqrE cannot fold properly in isolation, requiring the presence of other membrane subunits for stability and correct insertion into the membrane .

How can site-directed mutagenesis of NqrE contribute to understanding Na+ translocation mechanisms?

Site-directed mutagenesis of NqrE provides crucial insights into Na+ translocation mechanisms through several strategic approaches:

  • Charged Residue Substitutions: Replacing conserved charged amino acids (aspartate, glutamate) with neutral counterparts (asparagine, glutamine) in transmembrane segments can identify residues directly involved in Na+ coordination. Measurements of Na+ translocation activity in these mutants typically show 80-95% reduction when key residues are altered while maintaining complex assembly.

  • Cysteine Scanning Mutagenesis: Systematic replacement of residues with cysteine followed by accessibility studies using membrane-permeable and -impermeable sulfhydryl reagents helps map the Na+ translocation pathway through NqrE. This approach has successfully identified amino acids facing the ion channel versus those oriented toward the lipid bilayer or other subunits.

  • Conservative vs. Non-conservative Substitutions: Comparing effects of conservative substitutions (e.g., Asp to Glu) versus non-conservative changes (e.g., Asp to Ala) on Na+ affinity and translocation rates reveals the precise chemical requirements for ion coordination sites.

  • Cross-linking Studies: Introducing pairs of cysteines followed by oxidative cross-linking can establish proximity relationships between regions of NqrE and other subunits during different functional states of the complex.

Coupling these mutagenesis approaches with functional assays (22Na+ uptake in reconstituted proteoliposomes, membrane potential measurements) and structural studies creates a comprehensive map of the Na+ translocation pathway and mechanism .

What experimental approaches can determine the stoichiometry of Na+ translocation per NADH oxidized in the complete Na+-NQR complex?

Determining the precise stoichiometry of Na+ translocation per NADH oxidized requires sophisticated bioenergetic measurements:

  • Reconstituted Proteoliposome Systems: Purified Na+-NQR complex containing NqrE is reconstituted into liposomes with defined lipid composition. The internal volume is loaded with pH and Na+ sensitive fluorescent dyes or radioisotopes (22Na+).

  • Simultaneous Monitoring Method: An experimental setup allowing simultaneous measurement of:

    • NADH oxidation (absorbance decrease at 340 nm)

    • Na+ uptake (either via 22Na+ accumulation or Na+-sensitive fluorescent indicators)

    • Membrane potential (voltage-sensitive dyes like oxonol VI)

  • Inhibitor Studies: Specific inhibitors of Na+-NQR (such as 2-n-heptyl-4-hydroxyquinoline N-oxide or HQNO) are used as controls to confirm Na+ movement is specifically linked to complex activity.

  • Quantitative Analysis: Mathematical modeling of the initial rates of NADH consumption versus Na+ uptake across multiple substrate concentrations determines the coupling ratio.

This approach has revealed that approximately 1-2 Na+ ions are translocated per NADH molecule oxidized, though the exact stoichiometry can vary slightly depending on experimental conditions and the specific Vibrio species. The inclusion of recombinant NqrE with site-specific modifications can further elucidate how structural elements influence this stoichiometry .

How can researchers exploit the Na+-NQR complex for studying bacterial bioenergetics and membrane potential generation?

The Na+-NQR complex serves as an excellent model system for studying bacterial bioenergetics:

  • Primary Na+ Pump Model: Unlike better-studied H+-pumping respiratory complexes, Na+-NQR provides insights into alternative bioenergetic strategies employed by marine and pathogenic bacteria. Researchers can use purified NqrE along with other subunits to reconstitute primary sodium pumping in model membrane systems.

  • Comparative Bioenergetics: By expressing recombinant NqrE and other subunits in heterologous hosts like E. coli, researchers can conduct comparative studies between Na+ and H+ based bioenergetics, measuring growth rates, ATP production, and membrane potential under various conditions.

  • Biosensor Development: Engineered Na+-NQR complexes with fluorescent tags or modified NqrE can serve as biosensors for membrane potential or sodium concentration, useful in high-throughput screening applications.

  • Drug Discovery Platform: The Na+-NQR complex is absent in humans but present in several pathogenic Vibrio species, making it a potential antimicrobial target. Recombinant NqrE incorporated into screening platforms can identify compounds that specifically disrupt the complex.

  • Synthetic Biology Applications: Modified Na+-NQR components including NqrE can be incorporated into synthetic minimal cells or used to engineer bacteria with altered ion specificity, potentially creating microorganisms with novel energetic properties for biotechnological applications .

What are common challenges in expressing recombinant NqrE and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant NqrE:

  • Poor Expression Yields: As a membrane protein, NqrE often expresses at low levels or forms inclusion bodies.

    • Solution: Optimize by using specialized E. coli strains (C41(DE3), C43(DE3)) designed for membrane protein expression, lower induction temperature (16-20°C), and reduce IPTG concentration (0.1-0.2 mM).

  • Protein Misfolding: Improper folding reduces functional yield.

    • Solution: Co-express with molecular chaperones (GroEL/GroES), add compatible solutes (glycine betaine, proline) to the growth medium, or use fusion partners like Mistic that enhance membrane integration.

  • Toxicity to Host Cells: Overexpression of membrane proteins can disrupt host membrane integrity.

    • Solution: Use tightly regulated expression systems (like pBAD vectors with arabinose induction) that allow fine-tuning of expression levels.

  • Aggregation During Purification: NqrE can aggregate when extracted from membranes.

    • Solution: Screen multiple detergents (DDM, LMNG, CHAPS) at various concentrations, include glycerol (10-15%) in all buffers, and maintain low temperatures throughout purification.

  • Limited Stability: Purified NqrE often shows poor shelf-life.

    • Solution: Reconstitute into nanodiscs or amphipols after purification, which provide a more native-like environment than detergent micelles and significantly improve stability.

Implementing these strategies can increase functional yield from <0.1 mg/L in standard conditions to 1-5 mg/L of properly folded NqrE .

How can researchers differentiate between functional and non-functional forms of recombinant NqrE?

Distinguishing functional from non-functional recombinant NqrE requires multiple analytical approaches:

  • Size Exclusion Chromatography (SEC): Functional NqrE typically elutes as a well-defined peak corresponding to the monomer plus associated detergent micelle (approximately 45-55 kDa apparent molecular weight), while non-functional forms often appear as higher molecular weight aggregates or show abnormal elution profiles.

  • Thermal Stability Assays: Properly folded NqrE demonstrates a cooperative unfolding transition when analyzed by differential scanning fluorimetry (nanoDSF) or circular dichroism thermal melts. Non-functional forms typically show non-cooperative melting or multiple transition temperatures.

  • Proteolytic Fingerprinting: Limited proteolysis with trypsin or chymotrypsin generates distinct fragment patterns for properly folded NqrE versus misfolded variants when analyzed by SDS-PAGE or mass spectrometry.

  • Reconstitution Efficiency: Functional NqrE readily incorporates into liposomes with >70% efficiency, while non-functional forms show poor incorporation (<30%) and irregular distribution when visualized by freeze-fracture electron microscopy.

  • Complex Assembly Test: The ultimate test involves combining purified NqrE with other Na+-NQR subunits to reconstitute the complete complex. Only functional NqrE will properly integrate and contribute to measurable NADH oxidation coupled to Na+ translocation activity .

What strategies can address inconsistent results in NqrE-related experiments?

When researchers encounter inconsistent results in NqrE-related experiments, systematic troubleshooting approaches can identify and resolve the underlying issues:

  • Batch-to-Batch Variation:

    • Problem: Different preparations yield variable activity.

    • Solution: Implement stringent quality control including SEC-MALS to confirm monodispersity, CD spectroscopy to verify secondary structure, and establish functional benchmarks for each preparation. Standardize purification protocols with precise detergent-to-protein ratios.

  • Environmental Sensitivity:

    • Problem: NqrE function varies with buffer conditions.

    • Solution: Rigorously control pH (±0.1 units), temperature (±1°C), ionic strength, and ensure consistent Na+ concentration in all experimental buffers. NqrE function is particularly sensitive to Na+ concentration, requiring careful maintenance between 100-300 mM.

  • Lipid Dependency:

    • Problem: Activity varies with lipid environment.

    • Solution: Use defined lipid compositions for reconstitution (typically 70% phosphatidylethanolamine, 20% phosphatidylglycerol, 10% cardiolipin mimics native Vibrio membranes). Characterize protein:lipid ratios by phosphate assays and maintain consistent lipid-to-protein ratios.

  • Oxidative Damage:

    • Problem: NqrE contains oxidation-sensitive residues.

    • Solution: Include reducing agents (1-2 mM DTT or TCEP) in all buffers, prepare under nitrogen atmosphere when possible, and verify redox state using specific thiol-reactive probes.

  • Complex Assembly Variability:

    • Problem: Inconsistent incorporation into the full complex.

    • Solution: Develop a stepwise assembly protocol with validated intermediate complexes, use fluorescently labeled subunits to track assembly efficiency, and confirm complete complex formation by native PAGE or analytical ultracentrifugation .

How might structural biology techniques advance our understanding of NqrE function?

Cutting-edge structural biology approaches are transforming our understanding of NqrE's role in the Na+-NQR complex:

  • Cryo-Electron Microscopy (cryo-EM): Recent advances in single-particle cryo-EM now permit resolution of membrane protein structures without crystallization. Applied to the complete Na+-NQR complex, this technique can reveal the precise position and interactions of NqrE within the assembled complex at near-atomic resolution (2-3 Å). This approach has the advantage of capturing the complex in a more native-like lipid environment.

  • Solid-State NMR Spectroscopy: For studying specific dynamic regions of NqrE, solid-state NMR with selective isotopic labeling (15N, 13C) can provide detailed information about local conformational changes during the catalytic cycle. This is particularly valuable for identifying Na+ coordination sites within the transmembrane domains.

  • X-ray Free Electron Laser (XFEL) Studies: Time-resolved XFEL experiments with microcrystals of the Na+-NQR complex can potentially capture transient states during Na+ translocation, revealing the sequence of conformational changes involving NqrE during the ion pumping cycle.

  • Integrative Structural Biology: Combining lower-resolution techniques (small-angle X-ray scattering, mass photometry) with computational modeling and crosslinking-mass spectrometry creates comprehensive structural models of NqrE in different functional states.

These structural insights, when combined with functional data, will elucidate the molecular mechanism of sodium translocation and how electron transfer is coupled to ion movement through the coordinated action of all subunits including NqrE .

What is the potential role of Na+-NQR and NqrE in bacterial adaptation to different environments?

The Na+-NQR complex plays crucial roles in bacterial adaptation to diverse environments:

  • Marine Adaptation: In marine bacteria like V. fischeri, the Na+-NQR complex leverages the naturally high Na+ concentration gradient to drive energy conservation. Comparative genomic analyses show that NqrE sequence variations correlate with adaptation to different salinity levels, suggesting environment-specific optimization.

  • pH Tolerance: Unlike proton-pumping respiratory complexes, Na+-NQR function is less inhibited by alkaline pH, providing a bioenergetic advantage in high pH environments. NqrE's specific role in this adaptation involves maintaining ion selectivity even under pH stress.

  • Pathogenesis Mechanisms: In pathogenic Vibrio species, the Na+-NQR complex contributes to virulence by maintaining the membrane potential required for toxin secretion and antimicrobial resistance. NqrE variants found in clinical isolates may contribute to enhanced survival within hosts.

  • Temperature Adaptation: Comparative studies of NqrE from psychrophilic, mesophilic, and thermophilic bacteria reveal adaptive mutations that maintain functional flexibility at different temperatures, particularly in the transmembrane regions where ion coordination occurs.

  • Transition Metal Resistance: Some evidence suggests that the Na+-NQR complex contributes to heavy metal resistance in contaminated environments, with NqrE potentially participating in metal ion exclusion or efflux mechanisms.

Research using site-specific recombinant NqrE variants can help elucidate how these adaptations occur at the molecular level and potentially inform the engineering of bacteria for bioremediation or industrial applications in extreme environments .

How might studying NqrE contribute to understanding evolutionary relationships among bacterial respiratory complexes?

Investigating NqrE provides unique evolutionary insights into the diversification of respiratory complexes:

  • Evolutionary Origin: Phylogenetic analyses suggest that Na+-NQR evolved independently from H+-translocating respiratory complexes, with NqrE having no clear homologs in other respiratory systems. Sequence comparisons and structural modeling indicate that NqrE may have evolved from ancestral ion channels rather than from components of electron transport chains.

  • Gene Cluster Conservation: The arrangement of nqr genes in bacterial genomes shows remarkable conservation, with nqrE consistently positioned between nqrD and nqrF. This conservation suggests strong selective pressure to maintain the physical and functional relationships between these components.

  • Horizontal Gene Transfer: Evidence indicates that entire nqr operons, including nqrE, have been horizontally transferred between bacterial lineages, explaining their distribution patterns that sometimes contradict species phylogeny. Studying NqrE sequence variation can help trace these transfer events.

  • Functional Convergence: Despite their independent evolutionary origins, Na+-NQR and H+-translocating complex I achieve similar bioenergetic outcomes through different mechanisms. Comparing NqrE to membrane subunits of complex I reveals convergent solutions to the challenge of coupling electron transfer to ion translocation.

  • Ancestral Reconstruction: Using computational approaches to reconstruct ancestral NqrE sequences provides insights into the evolutionary trajectory of ion specificity and efficiency, potentially revealing how this complex adapted to different ecological niches.

This evolutionary perspective enhances our understanding of bioenergetic diversity and might inform the design of novel energy-transducing systems for synthetic biology applications .

What are the most promising future research directions for NqrE studies?

Several high-potential research directions emerge for NqrE studies:

  • Structure-Based Drug Design: With structural information about NqrE and its interactions within the Na+-NQR complex, researchers can develop selective inhibitors targeting this complex in pathogenic Vibrio species without affecting mammalian respiratory complexes. This approach could yield novel antimicrobials with reduced resistance potential.

  • Synthetic Biology Applications: Engineered NqrE variants with altered ion selectivity (Na+ vs. K+ vs. H+) could be incorporated into synthetic cellular systems for specialized bioenergetic functions, potentially creating microorganisms optimized for specific industrial processes or environmental conditions.

  • Nanoscale Bioelectronics: The electron transfer capabilities of the Na+-NQR complex, including NqrE's role in coupling this to ion movement, could inspire bio-hybrid electronic devices for energy conversion or sensing applications at the nanoscale.

  • Comparative Membrane Protein Folding: Systematic studies of NqrE folding and assembly could reveal general principles applicable to other multi-spanning membrane proteins, addressing a significant challenge in structural biology and protein engineering.

  • Ecological Monitoring Tools: Recombinant NqrE-based biosensors could be developed to monitor environmental sodium concentrations or membrane-active toxicants, particularly in marine environments where traditional monitoring tools may be less effective.

The combination of structural biology, synthetic biology, and biophysical approaches positions NqrE research at the intersection of fundamental science and practical applications in medicine, biotechnology, and environmental monitoring .

What key methodological advancements would accelerate research on Na+-NQR and NqrE?

Several methodological innovations would significantly advance NqrE research:

  • Improved Membrane Protein Expression Systems: Development of cell-free expression systems specifically optimized for membrane proteins like NqrE would overcome many current limitations in yield and folding efficiency. These systems could incorporate defined nanodiscs or lipid bilayers for direct insertion during translation.

  • Advanced Spectroscopic Techniques: Implementation of site-specific vibrational probes through unnatural amino acid incorporation could provide unprecedented details about electrostatic environments within NqrE's transmembrane domains during ion translocation.

  • In Vivo Structural Biology: Techniques for structural determination within living bacterial cells, such as in-cell NMR or advanced electron tomography, would reveal how the native cellular environment influences NqrE structure and function.

  • High-Throughput Mutagenesis Platforms: CRISPR-based saturating mutagenesis coupled with functional selection would enable comprehensive mapping of structure-function relationships across the entire NqrE sequence in a single experiment.

  • Computational Method Integration: Advanced molecular dynamics simulations incorporating quantum mechanical calculations could model the complete ion translocation pathway through NqrE and predict the energetics of this process with unprecedented accuracy.

  • Single-Molecule Techniques: Methods to study individual Na+-NQR complexes in action, such as single-molecule FRET or electrical recordings from reconstituted complexes, would reveal dynamic aspects of NqrE function obscured in ensemble measurements.

These methodological advances would bridge current knowledge gaps regarding the precise mechanism of ion selectivity and energy transduction in this fascinating bacterial respiratory complex .

How might understanding NqrE's function contribute to addressing current challenges in microbiology and biotechnology?

Research on NqrE has far-reaching implications for addressing significant challenges:

  • Antimicrobial Resistance: As a unique bacterial target absent in mammals, the Na+-NQR complex represents an attractive target for developing novel antibiotics, particularly against multidrug-resistant Vibrio species. Understanding NqrE's role in complex assembly provides opportunities for designing inhibitors that disrupt complex formation rather than activity, potentially reducing resistance development.

  • Bioremediation Strategies: Knowledge of how NqrE and the Na+-NQR complex function in high-salt environments can inform the development of engineered bacteria for bioremediation of saline contaminated sites, where conventional approaches often fail due to osmotic stress.

  • Biosynthetic Applications: The Na+ gradient established by Na+-NQR can drive secondary transporters for uptake or export of compounds. Engineered systems incorporating modified NqrE could enhance production of biofuels, bioplastics, or pharmaceuticals by improving energy efficiency in industrial microorganisms.

  • Models for Ion Channel Diseases: As a relatively simple model of ion translocation, NqrE research may provide insights applicable to understanding human channelopathies, potentially revealing fundamental principles of ion channel gating and selectivity.

  • Marine Microbial Ecology: Understanding the contribution of Na+-NQR to bacterial fitness in various marine niches could help predict how microbial communities will respond to changing ocean conditions, including acidification and warming, with implications for marine ecosystem function and biogeochemical cycling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.