Recombinant Vibrio fischeri Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
nqrE; VF_0729; VF0730; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Vibrio fischeri (strain ATCC 700601 / ES114)
Target Names
nqrE
Target Protein Sequence
MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGVAVVVVLTIAVPVNNLVY TYLLKENALVAGVDLTFLSFITFIGVIAALVQILEMILDRFFPPLYNALGIFLPLITVNC AIFGGVSFMVQRDYNFAESVVYGFGSGIGWMLAIVALAGIREKMKYSDVPPGLRGLGITF ITVGLMALGFMSFSGVQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the two-step reduction of ubiquinone-1 to ubiquinol. This process is coupled with the transport of Na+ ions from the cytoplasm to the periplasm. NqrA through NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links

KEGG: vfi:VF_0729

STRING: 312309.VF_0729

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the recommended storage and handling conditions for recombinant nqrE?

For optimal stability of recombinant nqrE protein, the following storage and handling conditions are recommended:

  • Storage buffer: Tris-based buffer with 50% glycerol, optimized specifically for this protein

  • Storage temperature: -20°C for regular storage, or -80°C for extended storage periods

  • Working conditions: Store working aliquots at 4°C for up to one week

  • Freeze-thaw cycles: Repeated freezing and thawing is not recommended as it may compromise protein stability

These conditions are designed to maintain the structural integrity and functional activity of nqrE, which is particularly important given its hydrophobic nature and role in the multi-subunit Na(+)-NQR complex.

How can researchers confirm the proper folding and activity of recombinant nqrE?

Confirming proper folding and activity of recombinant nqrE requires multiple complementary approaches:

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to evaluate secondary structure content

    • Thermal stability assays to determine protein folding integrity

    • Limited proteolysis to assess compact folding

  • Functional assays:

    • Na(+)-dependent NADH:quinone oxidoreductase activity measurements

    • Inhibition studies using specific Na(+)-NQR inhibitors such as 2-n-heptyl-4-hydroxyquinoline N-oxide (HQNO)

    • Assembly into the complete Na(+)-NQR complex with other recombinant subunits

  • Protein-protein interaction studies:

    • NMR spectroscopy to evaluate binding to other Na(+)-NQR subunits

    • Saturation transfer difference analysis to characterize interactions

    • Surface plasmon resonance measurements to quantify binding affinities

Given that mutations in the conserved cysteine residues of nqrE affect the proper folding and stability of the NQR complex , assessing these aspects is particularly important for confirming the functional integrity of recombinant nqrE preparations.

What experimental approaches can be used to study the role of nqrE in the bioenergetics of Vibrio fischeri?

Investigating the role of nqrE in V. fischeri bioenergetics requires sophisticated experimental approaches:

  • Genetic manipulation studies:

    • Construction of nqrE deletion mutants and point mutations of conserved residues

    • Complementation studies with wild-type and mutant nqrE variants

    • Phenotypic characterization under different growth conditions

  • Bioenergetic measurements:

    • Determination of membrane potential using fluorescent probes

    • Measurements of Na(+) gradients across the membrane

    • Oxygen consumption rates and NADH oxidation kinetics

    • ATP synthesis efficiency in wild-type versus nqrE mutants

  • Comparative metabolomics:

    • Metabolic profiling of wild-type versus nqrE mutant strains

    • Analysis of metabolic flux distribution using stable isotope labeling

    • Integration with transcriptomic data to identify compensatory pathways

Research has shown that loss of Na(+)-NQR in Vibrio species leads to multiple metabolic defects, including alterations in the TCA cycle and purine metabolism . Studies in V. cholerae indicated that deletion of the entire nqr operon results in upregulation of genes encoding lysine decarboxylase (cadA) and lysine/cadaverine antiporter (cadB), as well as downregulation of sialic acid catabolism genes . Similar approaches can be applied to study the specific contribution of nqrE to these metabolic changes in V. fischeri.

How can researchers investigate the role of nqrE in the symbiotic relationship between Vibrio fischeri and Euprymna scolopes?

The symbiosis between V. fischeri and the Hawaiian bobtail squid (E. scolopes) provides an excellent model system for studying the molecular mechanisms of animal-bacterial symbiosis . To investigate the specific role of nqrE in this relationship, researchers can employ these methodological approaches:

  • Quantitative colonization assays:

    • Implementation of the symbiotic dose-50 (SD50) protocol to quantify the symbiotic capacity of wild-type versus nqrE mutant strains

    • This method estimates the inoculum level necessary for establishing a light-emitting symbiosis and requires 2-5 fold fewer animals than traditional protocols

    • The Reed-Muench calculation method can be applied to determine SD50 values

  • Competitive colonization experiments:

    • Co-inoculation of juvenile squid with wild-type and nqrE mutant strains

    • Determination of relative colonization efficiency over time

    • Assessment of spatial distribution within the light organ

  • Transcriptomic analysis:

    • RNA-Seq comparison of host-associated V. fischeri cells versus planktonic cultures

    • Identification of genes co-regulated with nqrE during colonization

    • Integration with metabolic models to predict energy metabolism during symbiosis

  • Microscopy and imaging:

    • Visualization of colonization patterns using fluorescently labeled strains

    • Evaluation of bacterial density and distribution in the light organ

    • Time-course analysis of colonization efficiency

This combination of approaches would provide comprehensive insights into how nqrE contributes to the establishment and maintenance of the V. fischeri-E. scolopes symbiosis.

What techniques can be used to study the interaction between nqrE and other subunits of the Na(+)-NQR complex?

Understanding the interactions between nqrE and other Na(+)-NQR subunits requires specialized techniques:

  • NMR spectroscopy:

    • Saturation transfer difference NMR to identify interaction interfaces

    • Chemical shift perturbation analysis to map binding regions

    • This approach has already been successfully applied to study interactions within the Na(+)-NQR complex

  • Crystallographic studies:

    • X-ray crystallography of the entire Na(+)-NQR complex

    • Initial crystallization of the complex has been achieved using the sitting-drop method with a nanolitre dispenser

    • Optimization yielded crystals that diffracted to 4.0 Å resolution (space group P21, with unit-cell parameters a = 94, b = 146, c = 105 Å, α = γ = 90, β = 111°)

  • Cross-linking studies:

    • Chemical cross-linking followed by mass spectrometry to identify proximity relationships

    • Site-specific cross-linking using engineered cysteine residues

    • Analysis of crosslinked products to map subunit organization

  • FRET-based approaches:

    • Introduction of fluorescent probes at strategic positions in nqrE and other subunits

    • Measurement of fluorescence resonance energy transfer to determine distances

    • Real-time monitoring of complex assembly and conformational changes

These techniques would provide complementary information about the structural organization of the Na(+)-NQR complex and the specific role of nqrE within it.

How does the expression of nqrE change during different growth conditions and what regulatory mechanisms control it?

Understanding the regulation of nqrE expression requires comprehensive transcriptomic and regulatory analyses:

  • Transcriptome profiling:

    • RNA-Seq analysis of V. fischeri under different conditions:

      • Free-living versus host-associated states

      • Different carbon sources and growth phases

      • Varying Na(+) concentrations

    • Identification of conditions that alter nqrE expression patterns

  • Promoter analysis:

    • Characterization of the nqrE promoter region

    • Construction of reporter fusions to monitor expression

    • Identification of potential transcription factor binding sites

  • Regulatory network mapping:

    • ChIP-seq to identify transcription factors binding to the nqrE promoter

    • Perturbation studies using deletion of candidate regulators

    • Integration with global transcriptional data to place nqrE in regulatory networks

Transcriptomic analysis of V. fischeri during colonization of juvenile E. scolopes has revealed broad transcriptional changes, including gene expression patterns consistent with biochemical stresses inside the host and distinct metabolic patterns . Similar approaches can be used to specifically track nqrE expression under different physiological conditions.

What are the methodological challenges in studying the Na(+) translocation mechanism of the Na(+)-NQR complex containing nqrE?

Investigating the Na(+) translocation mechanism presents several methodological challenges:

  • Membrane protein reconstitution:

    • Development of proteoliposome systems containing the complete Na(+)-NQR complex

    • Optimization of lipid composition to maintain native activity

    • Verification of proper orientation in the membrane

  • Na(+) transport measurements:

    • Use of Na(+)-selective electrodes or fluorescent Na(+) indicators

    • Development of real-time assays to correlate electron transfer with Na(+) translocation

    • Distinction between Na(+) binding and actual translocation events

  • Identification of the Na(+) translocation pathway:

    • Site-directed mutagenesis of potential Na(+)-binding residues in nqrE and other subunits

    • Structural studies to identify conformational changes associated with Na(+) binding

    • Computational modeling of ion translocation pathways

  • Coupling mechanism analysis:

    • Investigation of how electron transfer is coupled to Na(+) translocation

    • Identification of key residues involved in energy coupling

    • Development of uncoupling conditions to separate electron transfer from Na(+) pumping

The study of Na(+) translocation is further complicated by the presence of multiple cofactors in the Na(+)-NQR complex, including a [2Fe-2S] cluster, FAD, riboflavin, FMNs, and potentially ubiquinone-8 , which creates a complex electron transfer pathway that must be coordinated with Na(+) movement.

How might structural studies of nqrE advance our understanding of Na(+)-coupled electron transport?

Detailed structural studies of nqrE would significantly advance our understanding of Na(+)-coupled electron transport in several ways:

The initial crystallization of the entire Na(+)-NQR complex that diffracted to 4.0 Å resolution provides a promising foundation for more detailed structural studies that could reveal the specific role of nqrE in the Na(+) translocation mechanism.

What insights can metabolic modeling provide about the role of Na(+)-NQR and nqrE in Vibrio fischeri physiology?

Metabolic modeling offers powerful approaches to understand the systems-level role of Na(+)-NQR and nqrE:

  • Genome-scale metabolic modeling:

    • Integration of transcriptomic data with metabolic models of V. fischeri

    • Prediction of metabolic flux distributions in wild-type versus nqrE mutants

    • Identification of metabolic bottlenecks and potential bypass pathways

  • Bioenergetic modeling:

    • Quantitative models of energy conversion efficiency

    • Prediction of growth yields under different conditions

    • Comparison of Na(+)-based versus H(+)-based bioenergetics

  • Host-microbe interaction modeling:

    • Prediction of metabolic exchanges in the squid-Vibrio symbiosis

    • Modeling of energy requirements during colonization

    • Integration of host and bacterial metabolic networks

Such modeling approaches would complement experimental studies and provide testable hypotheses about the broader physiological impact of nqrE function in V. fischeri.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.