Recombinant Vibrio fischeri Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and confirmed in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ubiB; VFMJ11_0047; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-544
Protein Length
full length protein
Species
Vibrio fischeri (strain MJ11)
Target Names
ubiB
Target Protein Sequence
MTPSELKRLYHITKVQLEYGLDELLPEHALTQLPKRLRKGLFWIKNKYPEKPLGERLRLA LQELGPVWIKFGQMMSTRRDLFPPHLADQLALLQDQVAPFDGQLAKDQMEMELGGPLDNW FTDFDIKPLASASIAQVHTAKLKDSGREIVLKVIRPDIRPVIESDIRLMYRMARLVEQHI PEARRLKPVEVIEEYEKTLLDELDLRREASNAMQLRRNFEGSEELYVPEVILDLSSEHLM VSERIYGIQVSDIEQLEKNGTNMKLLAERGVSVFFTQVFRDSFFHADMHPGNVFVNPDNP ENPQWIGLDCGIVGTLNKEDKRYLAENLLGFFNSDYHKVAQLHVDSGWVPADTNVEEFEF AIRMVCEPIFAKPLGEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGLGRQLYP QLDLWATAKPFLETWMAKQVGPAAFVTALSEKAPFWAEKLPELPDLVYDSLRQGKVLNQR MDKLYAGYRQSKRQQAKGQFLFNVGATLLICSAVLLTSNITVLASISAATGAAFWLFSWR AYRR
Uniprot No.

Target Background

Function
This protein is likely a protein kinase regulator of UbiI activity, which is involved in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Vibrio fischeri Probable ubiquinone biosynthesis protein UbiB?

UbiB from Vibrio fischeri is a 544 amino acid protein (Q5E8V3) that functions as a probable protein kinase involved in the ubiquinone biosynthesis pathway. The full-length protein contains an N-terminal regulatory domain and a C-terminal catalytic domain. The recombinant version is typically expressed with a His-tag to facilitate purification and downstream applications. The protein is essential for electron transport chain function and energy metabolism in V. fischeri .

How does UbiB contribute to V. fischeri's symbiotic relationship with marine organisms?

UbiB plays an indirect but critical role in V. fischeri's symbiotic relationships, particularly with the Hawaiian bobtail squid (Euprymna scolopes). By supporting ubiquinone biosynthesis, UbiB contributes to proper cellular respiration and energy production, which is essential for V. fischeri's bioluminescence capabilities. The light production is central to the symbiotic relationship with the squid, providing camouflage through counterillumination while the bacteria receive nutrients and protection within the squid's light organ .

The symbiotic relationship is highly specific, with the squid's light organ hosting only V. fischeri in a monoculture, while other organs like the accessory nidamental gland (ANG) host different bacterial consortia. This compartmentalization suggests metabolic barriers, potentially involving secondary metabolites that may be influenced by energy metabolism pathways where UbiB functions .

What methodological approaches are recommended for studying UbiB kinase activity?

To study UbiB kinase activity, researchers should implement a multi-faceted approach:

  • In vitro kinase assays: Use purified recombinant His-tagged UbiB protein (1-544aa) with potential substrate proteins in the presence of [γ-32P]ATP. Reaction conditions should include:

    • Buffer: 50 mM Tris-HCl (pH 7.5), 10 mM MgCl₂, 1 mM DTT

    • Temperature: 30°C for 30 minutes

    • Detection: Autoradiography following SDS-PAGE separation

  • Mass spectrometry-based phosphoproteomic analysis: Identify phosphorylation sites using LC-MS/MS after tryptic digestion of UbiB and its substrates.

  • Mutagenesis studies: Create point mutations at predicted active sites (particularly H362 and D794 by homology to other kinases) to assess their importance for function .

  • Coupled enzyme assays: Monitor ATP consumption using a luciferase-based system to quantify kinase activity in real-time.

When analyzing results, researchers should compare kinase activity under various conditions (pH, temperature, ion concentrations) to establish optimal enzymatic parameters .

How can researchers distinguish between direct and indirect effects of UbiB on ubiquinone biosynthesis?

Distinguishing direct from indirect effects requires several complementary approaches:

  • Metabolic profiling: Measure concentrations of ubiquinone precursors and end products in wild-type versus UbiB knockout strains using HPLC and LC-MS/MS.

  • Pulse-chase experiments: Use isotope-labeled precursors to track metabolic flux through the ubiquinone pathway with and without functional UbiB.

  • Protein-protein interaction studies: Employ proximity labeling techniques (BioID or APEX) coupled with mass spectrometry to identify proteins that directly interact with UbiB.

  • Time-course expression analysis: Use RNA-seq and proteomics to determine whether UbiB affects expression of other enzymes in the pathway.

  • In vitro reconstitution: Attempt to reconstitute specific steps of the ubiquinone biosynthesis pathway with purified components to determine which steps require UbiB directly.

Researchers should integrate data from these multiple approaches to build a comprehensive model of UbiB's role, distinguishing regulation (indirect) from catalytic activity (direct) .

What are the implications of UbiB function for V. fischeri biofilm formation and colonization capacity?

UbiB's role in energy metabolism has significant downstream effects on biofilm formation and colonization capacity:

  • Biofilm formation: Appropriate energy production is crucial for producing extracellular polymeric substances required for biofilm formation. Alterations in UbiB function could impact biofilm structure through changes in cellular energy status.

  • Host colonization: The symbiotic relationship between V. fischeri and the Hawaiian bobtail squid depends on bacterial colonization of the light organ, which requires both motility and biofilm-like aggregation in the squid mucus field. These processes are energy-dependent and may be influenced by UbiB-mediated ubiquinone production.

  • Cross-regulation with signaling systems: Two-component signaling (TCS) systems like RscS-SypF-SypG, which control symbiotic biofilm formation, may interact with or be influenced by energy metabolism pathways involving UbiB. There could be regulatory cross-talk between these systems and UbiB activity.

  • Competition with other bacterial species: Proper energy metabolism supported by UbiB function provides competitive advantages during initial colonization phases .

Research investigating these connections should employ both genetic approaches (knockouts, complementation) and phenotypic assays (biofilm quantification, colonization efficiency measurements) to establish causative relationships.

What are the optimal conditions for expression and purification of recombinant V. fischeri UbiB?

For optimal expression and purification of recombinant V. fischeri UbiB, researchers should follow this protocol:

Expression System and Conditions:

  • Host: E. coli BL21(DE3) or similar expression strain

  • Vector: pET-series with N-terminal His-tag

  • Induction: 0.5 mM IPTG when culture reaches OD₆₀₀ 0.6-0.8

  • Temperature: 18°C post-induction (critical for proper folding)

  • Duration: 16-18 hours

  • Medium: LB supplemented with 0.2% glucose

Purification Protocol:

  • Harvest cells by centrifugation (5,000 × g, 15 min, 4°C)

  • Resuspend in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 1 mM PMSF, 5% glycerol)

  • Lyse cells by sonication or French press

  • Clarify lysate by centrifugation (20,000 × g, 30 min, 4°C)

  • Capture using Ni-NTA affinity chromatography

  • Wash with buffer containing 20 mM imidazole

  • Elute with buffer containing 250 mM imidazole

  • Perform size exclusion chromatography using Superdex 200 column

  • Confirm purity by SDS-PAGE (>90% purity)

Storage Recommendations:

  • Store in Tris/PBS-based buffer with 6% trehalose, pH 8.0

  • Aliquot and store at -80°C

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

How should researchers reconstitute lyophilized UbiB protein for experimental use?

Proper reconstitution of lyophilized UbiB protein is critical for maintaining its activity:

  • Pre-reconstitution preparation:

    • Centrifuge the vial briefly to bring contents to the bottom

    • Allow the vial to reach room temperature before opening

  • Reconstitution procedure:

    • Add deionized sterile water to achieve a final concentration of 0.1-1.0 mg/mL

    • Mix gently by swirling or gentle pipetting (avoid vortexing)

    • Allow the protein to dissolve completely (15-30 minutes at room temperature)

  • Stabilization:

    • Add glycerol to a final concentration of 5-50% (recommended optimal: 50%)

    • Mix thoroughly but gently

  • Storage of reconstituted protein:

    • Prepare small aliquots to minimize freeze-thaw cycles

    • Store aliquots at -20°C or -80°C for long-term storage

    • Keep working aliquots at 4°C for up to one week

  • Quality control:

    • Verify protein concentration using Bradford or BCA assay

    • Check activity with appropriate functional assays before use in critical experiments

What experimental controls should be included when studying UbiB function in V. fischeri-host interactions?

When studying UbiB function in V. fischeri-host interactions, several critical controls should be included:

Genetic Controls:

  • Wild-type V. fischeri strain (positive control)

  • UbiB knockout mutant (ΔubiB)

  • Complemented strain (ΔubiB + ubiB on plasmid)

  • Site-directed mutants (mutations in key functional residues, e.g., H362A and D794A)

  • Overexpression strain (ubiB under control of inducible promoter)

Biochemical Controls:

  • Kinase-dead UbiB variant (negative control for activity assays)

  • Heat-inactivated UbiB protein (negative control)

  • Alternative kinases from V. fischeri (specificity controls)

Host Interaction Controls:

  • Non-symbiotic bacterial species (e.g., E. coli as negative control)

  • Other V. fischeri strains with varying colonization capacities

  • Host specimens without bacterial exposure (axenic controls)

  • Host specimens colonized with mixed bacterial populations

Experimental Design Controls:

  • Time-matched samples for all experimental conditions

  • Technical replicates (minimum n=3)

  • Biological replicates across multiple host specimens (minimum n=5)

  • Environmental parameter controls (temperature, salinity, light conditions)

These controls help distinguish UbiB-specific effects from general bacterial processes and account for host variability in the symbiotic relationship .

What analytical techniques are most effective for studying UbiB-mediated ubiquinone biosynthesis?

To effectively study UbiB-mediated ubiquinone biosynthesis, researchers should employ a combination of analytical techniques:

Chromatographic Methods:

  • HPLC with UV detection: For quantification of ubiquinone and intermediates

    • Column: C18 reverse phase

    • Mobile phase: Methanol:hexane (9:1)

    • Detection: 275 nm for ubiquinone

  • LC-MS/MS: For detailed characterization of biosynthetic intermediates

    • Ionization: ESI in positive mode

    • MRM transitions: Specific to ubiquinone and known intermediates

Metabolic Analysis:

  • Isotope-labeled precursor studies: Track flux through the pathway using ¹³C or ¹⁴C-labeled precursors

  • Metabolomics profiling: Compare metabolite levels between wild-type and UbiB-mutant strains

Enzymatic Activity Assays:

  • Oxygen consumption assays: Measure respiratory function

  • ATP production assays: Quantify energy generation capacity

  • Specific enzyme activity assays: For each step in the ubiquinone pathway

Molecular Biology Approaches:

  • qRT-PCR: Monitor expression of genes in the ubiquinone biosynthesis pathway

  • ChIP-seq: Identify potential regulatory interactions

Data Analysis Considerations:

  • Use internal standards for accurate quantification

  • Perform time-course studies to capture dynamic changes

  • Integrate data across multiple analytical platforms for comprehensive understanding

How can researchers determine if UbiB mutations affect V. fischeri bioluminescence through disruption of ubiquinone biosynthesis?

To establish a causative link between UbiB mutations, ubiquinone biosynthesis, and bioluminescence, researchers should follow this experimental workflow:

Step 1: Generate and confirm UbiB mutants

  • Create precise mutations in the ubiB gene using site-directed mutagenesis

  • Verify mutations by sequencing

  • Confirm protein expression levels by Western blot

Step 2: Quantify ubiquinone levels

  • Extract and measure ubiquinone concentrations by HPLC-MS

  • Compare wild-type, UbiB mutant, and complemented strains

  • Analyze all ubiquinone species (UQ-8, UQ-9, UQ-10)

Step 3: Assess bioluminescence

  • Measure light production using a luminometer

  • Record time-course bioluminescence under standard conditions

  • Compare peak intensity and kinetics across strains

Step 4: Rescue experiments

  • Supplement growth media with synthetic ubiquinone

  • Determine if exogenous ubiquinone restores bioluminescence in UbiB mutants

  • Test various concentrations to establish dose-response relationship

Step 5: Integrative analysis

  • Calculate Pearson correlation coefficients between ubiquinone levels and luminescence

  • Perform pathway flux analysis to identify rate-limiting steps

  • Develop a mathematical model linking ubiquinone availability to light production

Step 6: In vivo validation

  • Test colonization and light organ luminescence in the Hawaiian bobtail squid model

  • Compare host fitness parameters between wild-type and mutant-colonized specimens

This comprehensive approach can distinguish direct effects of UbiB on bioluminescence from indirect effects mediated through ubiquinone biosynthesis disruption .

What are common challenges in working with recombinant V. fischeri UbiB and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant V. fischeri UbiB protein. Here are the most common issues and their solutions:

ChallengeProbable CauseSolution
Low expression yieldToxicity to host cellsUse C41(DE3) or C43(DE3) E. coli strains specialized for toxic proteins
Codon biasOptimize codons for E. coli expression
Formation of inclusion bodiesExpress at lower temperature (16-18°C) with reduced IPTG concentration (0.1-0.2 mM)
Poor solubilityMembrane associationAdd 0.5-1% non-ionic detergents (Triton X-100 or DDM) to extraction buffer
Improper foldingCo-express with chaperones (GroEL/GroES system)
AggregationInclude 5-10% glycerol and 1 mM EDTA in all buffers
Loss of activityOxidation of critical cysteinesMaintain reducing conditions with 1-5 mM DTT or 2-10 mM β-mercaptoethanol
Metal ion lossSupplement buffers with 0.1-0.5 mM Mg²⁺ or Mn²⁺
Proteolytic degradationAdd protease inhibitor cocktail and work at 4°C
Inconsistent activity assaysCo-purifying contaminantsInclude additional purification steps (ion exchange chromatography)
Substrate limitationsEnsure saturating concentrations of all substrates
Buffer incompatibilityTest multiple buffer systems (HEPES, MOPS, Tris)

When troubleshooting, systematically test each variable independently and document all conditions precisely. This methodical approach will help identify the specific factors affecting your recombinant UbiB preparation .

How should researchers interpret conflicting data between in vitro and in vivo studies of UbiB function?

When faced with discrepancies between in vitro and in vivo studies of UbiB function, researchers should consider:

  • Contextual differences:

    • In vitro systems lack the complex cellular environment including potential cofactors, regulators, and membrane structures

    • V. fischeri exists in different metabolic states in laboratory cultures versus symbiotic relationships

  • Systematic analysis approach:

    • Create a comparative matrix of all experimental conditions

    • Identify specific variables that differ between in vitro and in vivo systems

    • Design experiments to test each variable independently

  • Reconciliation strategies:

    • Develop intermediate complexity models (e.g., cell-free extracts, reconstituted membrane systems)

    • Use genetic approaches to modify in vivo systems to more closely match in vitro conditions

    • Apply computational modeling to predict how isolated components would behave in complex systems

  • Data integration framework:

ParameterIn Vitro ObservationIn Vivo ObservationPotential ExplanationValidation Approach
Kinase activityHigh activity toward artificial substratesSelective phosphorylationCellular compartmentalization or scaffolding proteinsProximity labeling experiments
Ubiquinone productionDirect correlation with UbiB levelsComplex relationship with multiple factorsRegulatory feedback loopsMetabolic flux analysis
Growth effectsMinimal impact in rich mediaSignificant impact during colonizationEnvironmental or host-derived factorsDefined media experiments with specific limitations
Interaction partnersLimited binding partnersComplex interaction networkCellular context and concentration differencesCrosslinking mass spectrometry
  • Interpreting apparent contradictions:

    • Consider UbiB may have multiple functions depending on cellular context

    • Examine temporal aspects (acute vs. chronic effects)

    • Evaluate dose-dependency relationships

What emerging technologies could advance our understanding of UbiB function in V. fischeri?

Several cutting-edge technologies hold promise for elucidating UbiB function:

  • Cryo-electron microscopy (Cryo-EM):

    • Determine high-resolution structures of UbiB in different conformational states

    • Visualize interactions with binding partners and substrates

    • Map the protein within membrane contexts

  • Single-molecule techniques:

    • FRET (Förster Resonance Energy Transfer) to monitor conformational changes

    • Single-molecule tracking to observe UbiB dynamics in live cells

    • Optical tweezers to measure binding forces with interaction partners

  • Advanced genetic tools:

    • CRISPR interference for precise temporal control of UbiB expression

    • Base editing for creating point mutations without selection markers

    • Optogenetic control of UbiB activity

  • Systems biology approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Flux balance analysis of metabolic networks

    • Machine learning for pattern recognition in complex datasets

  • Novel imaging techniques:

    • Super-resolution microscopy to visualize UbiB localization

    • Mass spectrometry imaging to map ubiquinone distribution

    • Correlative light and electron microscopy (CLEM) to connect function with structure

  • Synthetic biology strategies:

    • De novo design of minimal ubiquinone biosynthesis pathways

    • Orthogonal translation systems for introducing non-canonical amino acids

    • Cell-free expression systems for rapid prototyping

Implementing these technologies requires interdisciplinary collaboration but offers unprecedented insights into UbiB's role in V. fischeri metabolism and symbiotic relationships .

How might studying UbiB contribute to understanding broader aspects of bacterial-host symbiosis?

Research on UbiB has significant implications for understanding bacterial-host symbiotic relationships:

  • Metabolic integration between symbiotic partners:

    • UbiB's role in energy metabolism represents a critical interface between bacterial fitness and host biology

    • Understanding how energy metabolism is regulated during symbiosis establishment may reveal conserved principles across diverse symbiotic systems

  • Evolutionary considerations:

    • Comparative analysis of UbiB across symbiotic and non-symbiotic bacteria may reveal adaptation signatures

    • Potential co-evolution between host metabolic requirements and bacterial energy production systems

  • Host-microbe communication:

    • Metabolites produced through UbiB-dependent pathways might serve as signaling molecules between symbiotic partners

    • Respiratory status signaled through electron transport chain components could coordinate bacterial behavior with host physiology

  • Symbiotic specificity mechanisms:

    • The Hawaiian bobtail squid maintains V. fischeri exclusively in its light organ while hosting different bacteria in other organs

    • Energy metabolism differences mediated by UbiB might contribute to this compartmentalization through indirect effects on bacterial competitiveness

  • Therapeutic applications:

    • Insights from natural symbiotic systems could inform the development of engineered probiotics

    • Understanding metabolic interdependencies may help design intervention strategies for disrupting harmful host-microbe interactions

  • Model system development:

    • The V. fischeri-squid system, including UbiB research, serves as a tractable model for more complex host-microbiome relationships

    • Methodological advances in this system can be applied to less accessible symbiotic relationships

This research connects fundamental biochemistry to ecology and evolution, potentially revealing principles applicable across diverse symbiotic systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.