Recombinant Vibrio fischeri Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Protein Overview

HtpX belongs to the heat shock protein family and functions as a zinc-dependent endoprotease. In V. fischeri, it is recombinantly expressed with a His₆ tag for purification . Key features include:

  • UniProt IDs: B5FDN8 (strain MJ11) and Q5E5P9 (strain ES114) .

  • Sequence: 291 amino acids (1–291 region) .

  • EC Number: 3.4.24.- (metalloproteases) .

  • Buffer: Tris-based buffer with 50% glycerol .

PropertyValue
Molecular Weight (kDa)Not explicitly reported (inferred ~33 kDa based on sequence length)
Zinc DependencyConfirmed (zinc required for catalytic activity)
Substrate SpecificityBroad (membrane and soluble proteins, e.g., SecY)

Sequence Analysis

The amino acid sequences of HtpX from V. fischeri strains MJ11 and ES114 show high similarity, with minor differences:

  • Position 241: FIVSTILEL (MJ11) vs. FIVSTVLEL (ES114) .

  • Key Motifs:

    • Active Site: Contains zinc-binding residues (e.g., histidines) .

    • Self-Cleavage: Demonstrated in E. coli HtpX under zinc-induced conditions .

Inferred Roles in Protein Quality Control

While V. fischeri HtpX has not been directly studied, its E. coli homolog participates in:

  • Membrane Protein Degradation: Cleaves SecY and other misfolded proteins .

  • Stress Response: Activated during cellular stress (e.g., heat shock) .

  • Zinc Dependency: Requires Zn²⁺ for catalytic activity, with self-degradation observed in its absence .

Experimental Challenges

Recombinant HtpX purification requires careful handling due to:

  • Self-Degradation: Spontaneous cleavage upon cell disruption or membrane solubilization .

  • Refolding Requirements: Purification under denaturing conditions followed by refolding with zinc supplementation .

Research Gaps

  • Functional Studies: No published data on V. fischeri HtpX's role in symbiosis or host interactions.

  • Regulatory Pathways: Unlike E. coli, its interaction with FtsH or other proteases remains unexplored.

Comparative Analysis with E. coli HtpX

FeatureV. fischeri HtpX (Inferred) E. coli HtpX
Zinc RequirementYes (tagged recombinant)Yes (confirmed in vitro)
Substrate SpecificityNot reportedCasein, SecY, self-cleavage
Purification MethodMetal affinity chromatographyDenaturing/refolding protocols

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
htpX; VFMJ11_1232; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Vibrio fischeri (strain MJ11)
Target Names
htpX
Target Protein Sequence
MKRIALFLATNLAVMIVFSIVLNIVYAVTGIQQGSLSGLLVMAVLFGFGGSLISLMMSKS MALRSVGGEVIEQPRNETEHWLLETVSRQAQQVGIGMPTVAIYDSPDMNAFATGAKRDDS LVAVSTGLLHSMTRDEAEAVLAHEVSHIANGDMITMTLMQGVVNTFVIFLSRMIANAVSG FTSSDEEGEGEGGSFMTYFIVSTILELAFGFLASFLTMWFSRHREFHADAGAAQLVGKQK MIAALERLRMGQESQLEGSMMAFGINGKKSLTELLMSHPPLEKRIDALRQM
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.