Recombinant Vibrio fischeri UPF0208 membrane protein VFMJ11_0876 (VFMJ11_0876)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Advance notification is required for dry ice shipments, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
VFMJ11_0876; UPF0208 membrane protein VFMJ11_0876
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-149
Protein Length
full length protein
Species
Vibrio fischeri (strain MJ11)
Target Names
VFMJ11_0876
Target Protein Sequence
MSENGFLFRFRDGQTYMDTWPERKELAPMFPEQRVIKATKFAVKVMPAVAVISVLTQMVF NNTAGLPQAIIIALFAISMPLQGFWWLGNRANTKLPPALASWYRELYQKIIESGAALEPM KSQPRYKELANILNKAFKQLDKTALERWF
Uniprot No.

Target Background

Database Links
Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is VFMJ11_0876 and what are its basic structural characteristics?

VFMJ11_0876 is a UPF0208 family membrane protein from Vibrio fischeri with 149 amino acids. It belongs to the uncharacterized protein family UPF0208, which comprises membrane proteins with largely unknown functions. The protein's structural features include transmembrane domains that anchor it to the bacterial cell membrane, which presents unique challenges for expression and purification in research settings . When working with this protein, researchers should account for its hydrophobic regions that are typical of membrane proteins, which significantly impacts solubility and stability during experimental procedures.

What expression systems are most effective for producing recombinant VFMJ11_0876?

While multiple expression systems can be used for VFMJ11_0876, E. coli remains the most commonly utilized host for initial expression studies. The protein can be expressed as a His-tagged recombinant full-length protein (1-149 amino acids) in E. coli systems . Alternative expression platforms include yeast, mammalian, and insect cell systems, each offering distinct advantages depending on experimental requirements . For membrane proteins like VFMJ11_0876, E. coli BL21(DE3) strains are often preferred for initial screening, while specialized strains like Rosetta-GAMI may improve expression of proteins containing rare codons . Methodologically, researchers should optimize expression conditions by testing different temperatures, induction times, and inducer concentrations to maximize protein yield and proper folding.

Why is VFMJ11_0876 classified as a UPF0208 family protein and what does this classification indicate?

The UPF0208 designation (Uncharacterized Protein Family 0208) indicates that VFMJ11_0876 belongs to a group of proteins with conserved sequence features whose functions have not been fully characterized. This classification suggests that while the protein's sequence has been identified and conserved across various species, its biochemical activities, physiological roles, and structural properties remain largely unknown . For researchers, this classification signals an opportunity for novel discoveries but also highlights the need for comprehensive functional studies starting with comparative genomic analyses, structural predictions, and expression pattern examinations.

What strategies can overcome the challenges associated with expressing full-length VFMJ11_0876?

The expression of full-length VFMJ11_0876 presents several challenges typical of membrane proteins. To overcome these difficulties, researchers should implement the following methodological approaches:

  • Codon optimization: Analyze the protein sequence for rare codons in the expression host and optimize accordingly to improve translation efficiency .

  • Fusion tags selection: Utilize solubility-enhancing tags such as MBP (maltose-binding protein) or GST (glutathione S-transferase) in addition to affinity tags like His-tag to improve folding and solubility .

  • Expression conditions optimization: Test various temperatures (typically lower temperatures of 16-25°C slow down expression and improve folding), inducer concentrations, and induction times to find optimal conditions .

  • Specialized expression strains: Consider using E. coli strains specifically designed for membrane protein expression, such as C41(DE3) or C43(DE3) .

  • Detergent screening: Identify appropriate detergents for membrane protein solubilization through systematic screening of different detergent classes and concentrations .

How can one distinguish between properly folded VFMJ11_0876 and misfolded protein aggregates?

Distinguishing between properly folded VFMJ11_0876 and protein aggregates requires multiple analytical approaches:

  • Size exclusion chromatography (SEC): Properly folded membrane proteins typically elute as well-defined peaks, while aggregates appear in the void volume. This method provides a practical way to separate and identify correctly folded protein fractions .

  • Circular dichroism (CD) spectroscopy: This technique allows assessment of secondary structure content. Properly folded membrane proteins show characteristic spectra with minima at 208 and 222 nm, indicating α-helical content typical of transmembrane domains .

  • Thermal shift assays: Correctly folded proteins exhibit cooperative unfolding transitions when heated, while aggregates show irregular thermal profiles. This provides a quantitative measure of protein stability and folding state .

  • Functional assays: When possible, activity-based assays provide the most definitive evidence of proper folding. For membrane proteins with unknown function like VFMJ11_0876, binding assays with potential ligands may serve as proxies for correct folding .

What are the optimal buffer conditions for maintaining VFMJ11_0876 stability after purification?

The stability of purified VFMJ11_0876 depends critically on buffer composition. Since it's a membrane protein, the following buffer components should be considered:

  • Detergent selection: Mild non-ionic detergents (e.g., DDM, LMNG) at concentrations slightly above their critical micelle concentration are typically effective for maintaining membrane protein stability .

  • pH optimization: Testing a range of pH conditions (typically 6.5-8.0) is essential, as pH significantly affects membrane protein stability. Phosphate or Tris buffers are commonly used .

  • Salt concentration: 100-300 mM NaCl is typically included to maintain ionic strength and reduce non-specific interactions .

  • Stabilizing additives: Glycerol (5-10%), cholesterol hemisuccinate, or specific lipids may enhance stability by mimicking the native membrane environment .

  • Antioxidants: Addition of reducing agents like DTT or β-mercaptoethanol (1-5 mM) helps prevent oxidation of cysteine residues that can lead to aggregation .

What experimental methods are most appropriate for investigating the potential functions of VFMJ11_0876?

Given the limited information about VFMJ11_0876's function, researchers should employ multiple complementary approaches:

  • Comparative genomics analysis: Examine genomic context and conserved neighboring genes to identify potential functional relationships and pathways. This can provide initial hypotheses about VFMJ11_0876's role in V. fischeri .

  • Protein-protein interaction studies: Techniques such as bacterial two-hybrid systems, co-immunoprecipitation with tagged versions of VFMJ11_0876, or pull-down assays can identify interaction partners, potentially revealing functional associations .

  • Gene knockout/knockdown studies: Generate VFMJ11_0876 deletion mutants in V. fischeri and perform phenotypic analyses to observe effects on growth, biofilm formation, motility, or other cellular processes .

  • Localization studies: Use fluorescent protein fusions or immunofluorescence microscopy to determine the precise subcellular localization of VFMJ11_0876, which can provide clues about its function .

  • Transcriptomic analyses: Compare gene expression profiles between wild-type and VFMJ11_0876 mutant strains to identify affected pathways and processes .

How might VFMJ11_0876 contribute to Vibrio fischeri's symbiotic relationship with host organisms?

While direct information about VFMJ11_0876's role in symbiosis is not explicitly provided in the search results, we can formulate methodological approaches to investigate this question:

  • Colonization assays: Compare the ability of wild-type and VFMJ11_0876 mutant strains to colonize the light organ of Euprymna scolopes (Hawaiian bobtail squid). Quantify bacterial populations at different time points post-inoculation to assess colonization efficiency .

  • Host response analysis: Examine host tissue responses (e.g., mucus production, hemocyte trafficking, developmental patterns) to wild-type versus mutant strains to determine if VFMJ11_0876 affects host-microbe signaling .

  • OMV analysis: Investigate whether VFMJ11_0876 is present in outer membrane vesicles (OMVs) that V. fischeri releases, which are known to influence host development and immune responses .

  • Biofilm formation assessment: Since V. fischeri forms biofilms during initial colonization stages, compare biofilm formation capabilities between wild-type and mutant strains using in vitro and in vivo models .

  • Competitive colonization experiments: Co-inoculate host animals with wild-type and mutant strains to assess competitive fitness in the symbiotic environment, which can reveal subtle functional contributions .

What approaches can be used to determine the three-dimensional structure of VFMJ11_0876?

Determining the structure of membrane proteins like VFMJ11_0876 presents unique challenges. The following methodological approaches can be employed:

  • X-ray crystallography: Requires producing highly pure, homogeneous protein samples that can form well-ordered crystals. For membrane proteins, this often involves using detergent micelles or lipidic cubic phases to mimic the membrane environment .

  • Cryo-electron microscopy (cryo-EM): This approach is increasingly valuable for membrane proteins as it doesn't require crystallization. Sample preparation involves vitrification of purified protein in detergent micelles or reconstituted into nanodiscs .

  • Nuclear magnetic resonance (NMR) spectroscopy: Suitable for smaller membrane proteins, requiring isotopically labeled protein samples (typically with 13C and 15N). Solution NMR or solid-state NMR approaches may be used depending on protein size and stability .

  • Computational structure prediction: With recent advances in AI-based structure prediction tools like AlphaFold2, computational approaches can provide valuable structural insights, especially when combined with experimental validation .

  • Hybrid approaches: Combining low-resolution experimental data with computational modeling can provide structural insights when high-resolution structures are challenging to obtain .

How can site-directed mutagenesis be used to probe structure-function relationships in VFMJ11_0876?

Site-directed mutagenesis represents a powerful approach to investigate structure-function relationships in proteins like VFMJ11_0876:

  • Conservation-based targeting: Identify highly conserved residues across UPF0208 family members as potential functionally important sites. These residues are prime candidates for mutagenesis .

  • Transmembrane domain analysis: Target residues within predicted transmembrane segments to assess their contribution to membrane insertion, protein stability, and function .

  • Charge reversal mutations: Introduce charge reversals at potentially important electrostatic interaction sites to disrupt protein folding or interactions with partners .

  • Cysteine scanning mutagenesis: Systematically replace residues with cysteine to enable subsequent chemical modification or cross-linking studies, providing insights into protein structure and dynamics .

  • Functional domain mapping: Create truncation mutants to identify minimal functional domains and essential regions of the protein .

How does VFMJ11_0876 potentially relate to the well-characterized quorum sensing and bioluminescence systems in Vibrio fischeri?

While direct evidence linking VFMJ11_0876 to quorum sensing is not provided in the search results, we can outline experimental approaches to investigate potential connections:

  • Expression analysis under quorum conditions: Examine VFMJ11_0876 expression levels under different cell densities and in the presence/absence of acyl-homoserine lactones (3OC6-HSL and C8-HSL) to determine if its expression is quorum-regulated .

  • LuxR-binding studies: Investigate whether the VFMJ11_0876 promoter region contains "lux box" sequences that might be recognized by LuxR, which would suggest quorum-dependent regulation .

  • Bioluminescence assays: Compare luminescence patterns between wild-type and VFMJ11_0876 mutant strains under various conditions to assess potential effects on light production .

  • Signaling molecule transport: Test whether VFMJ11_0876, as a membrane protein, might be involved in transport or detection of signaling molecules like HSLs using radioactively labeled acyl-HSLs and transport assays .

  • Protein-protein interaction studies: Examine potential interactions between VFMJ11_0876 and known components of the quorum sensing machinery (LuxI, LuxR, LuxS) using co-immunoprecipitation or bacterial two-hybrid approaches .

What role might VFMJ11_0876 play in Vibrio fischeri's membrane biology and cell surface interactions?

As a membrane protein, VFMJ11_0876 likely contributes to V. fischeri's membrane biology in several potential ways:

  • Membrane integrity assessment: Compare membrane permeability, fluidity, and composition between wild-type and VFMJ11_0876 mutant strains using fluorescent dyes, electron microscopy, and lipidomic analyses .

  • Outer membrane vesicle (OMV) analysis: Quantify and characterize OMVs produced by wild-type versus mutant strains to determine if VFMJ11_0876 affects OMV production, content, or delivery to host cells .

  • Surface adhesion studies: Evaluate the ability of wild-type and mutant strains to adhere to various surfaces, including host tissues and abiotic surfaces, to assess potential roles in adhesion .

  • Biofilm matrix analysis: Compare extracellular polymeric substance composition and structure in biofilms formed by wild-type and mutant strains to identify potential contributions to biofilm architecture .

  • Host recognition experiments: Test recognition of bacterial surface components by host pattern recognition receptors to determine if VFMJ11_0876 affects host-microbe recognition processes .

How conserved is VFMJ11_0876 across different Vibrio species and what does this reveal about its evolutionary significance?

Understanding the evolutionary conservation of VFMJ11_0876 requires systematic comparative genomics analyses:

  • Sequence homology searching: Perform BLAST searches against genomic databases to identify homologs across Vibrio species and other bacterial genera. Calculate sequence identity and similarity percentages to quantify conservation levels .

  • Phylogenetic analysis: Construct phylogenetic trees of VFMJ11_0876 homologs to visualize evolutionary relationships and identify potential functional divergence events .

  • Synteny analysis: Examine the genomic context of VFMJ11_0876 homologs across different species to identify conserved gene neighborhoods that might suggest functional associations .

  • Selection pressure analysis: Calculate dN/dS ratios to determine whether VFMJ11_0876 is under purifying selection (suggesting conserved function) or positive selection (suggesting adaptive evolution) .

  • Domain architecture comparison: Identify potential domain fusion or fission events in VFMJ11_0876 homologs that might provide insights into functional evolution .

What experimental approaches can determine if VFMJ11_0876 interacts with host factors during symbiosis?

Investigating interactions between VFMJ11_0876 and host factors requires specialized experimental approaches:

  • Pull-down assays with host tissue: Use tagged VFMJ11_0876 to pull down potential interacting host proteins from squid tissue lysates, followed by mass spectrometry identification .

  • Yeast two-hybrid or bacterial two-hybrid screening: Screen VFMJ11_0876 against host protein libraries to identify potential interaction partners in a systematic manner .

  • Biolayer interferometry or surface plasmon resonance: Test direct binding between purified VFMJ11_0876 and candidate host proteins to quantify binding affinities and kinetics .

  • Cross-species complementation: Express squid proteins in bacterial systems or bacterial proteins in eukaryotic cells to test for functional complementation or interference .

  • In vivo crosslinking: Perform crosslinking experiments during active symbiosis to capture transient interactions between bacterial and host proteins .

How can structural information about VFMJ11_0876 be leveraged for biotechnological applications?

Structural knowledge of VFMJ11_0876 could enable various biotechnological applications:

  • Membrane protein engineering platform: The structure of VFMJ11_0876 could provide a scaffold for designing novel membrane proteins with desired properties for synthetic biology applications .

  • Biosensor development: If binding partners or ligands are identified, VFMJ11_0876 could be engineered into biosensors for detecting specific molecules in environmental or clinical samples .

  • Drug delivery systems: Understanding the membrane insertion mechanisms of VFMJ11_0876 could inform the design of protein-based drug delivery vesicles or nanoparticles .

  • Crystallization chaperones: Stable domains from VFMJ11_0876 could be used as fusion partners to facilitate the crystallization of other challenging membrane proteins .

  • Protein-based nanomaterials: The self-assembly properties of membrane proteins like VFMJ11_0876 could be exploited to create novel nanomaterials with defined architectures and functions .

What experimental design considerations are important when investigating the functional role of VFMJ11_0876 in biofilm formation?

Investigating VFMJ11_0876's role in biofilm formation requires careful experimental design:

  • Biofilm model selection: Choose appropriate in vitro biofilm models that recapitulate relevant aspects of V. fischeri's natural biofilm formation, including static and flow-based systems .

  • Quantitative biofilm assays: Implement crystal violet staining, confocal microscopy, and biomass measurements to quantitatively compare biofilm formation between wild-type and mutant strains .

  • Stage-specific analysis: Examine effects on initial attachment, microcolony formation, mature biofilm development, and dispersal phases to pinpoint when VFMJ11_0876 functions .

  • Mixed-species biofilms: Test biofilm formation in the presence of other marine bacteria to assess competitive fitness and interspecies interactions .

  • Gene expression profiling: Compare expression patterns of known biofilm-related genes (including those for cellulose synthesis and the LapV adhesin) between wild-type and VFMJ11_0876 mutant strains during biofilm formation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.