The ATP synthase subunit a 1 serves a crucial function in bacterial energy metabolism. As part of the membrane-embedded F0 sector of ATP synthase, it participates in proton translocation across the cell membrane, which drives the synthesis of ATP. This process represents a fundamental mechanism for energy conversion in living organisms.
The F0 sector forms a proton channel across the membrane, and subunit a specifically provides the pathway for proton movement. The movement of protons through this channel causes rotation of other ATP synthase components, which in turn drives conformational changes in the F1 sector that catalyze the synthesis of ATP from ADP and phosphate.
In Vibrio harveyi, ATP synthesis is essential for various cellular processes, including bioluminescence, which is a characteristic feature of this marine bacterium. The energy provided by ATP is utilized in the light-producing reaction catalyzed by luciferase, where a long-chain aldehyde is oxidized along with reduced flavin mononucleotide (FMNH2) .
The integration of ATP synthase function with cellular physiology in V. harveyi is complex and involves coordination with other metabolic pathways. Unlike some other bacterial enzymes such as acyl-ACP synthetase (which has been studied in V. harveyi and appears to be a soluble hydrophilic enzyme), the ATP synthase complex, including atpB1, is membrane-bound, reflecting its role in membrane-associated energy transduction .
The recombinant form of Vibrio harveyi ATP synthase subunit a 1 is produced for research purposes through various expression systems. While specific production methods for this particular protein are not detailed in the available search results, recombinant protein production typically involves:
Cloning the atpB1 gene into an appropriate expression vector
Transforming the vector into a suitable host organism (often E. coli)
Inducing protein expression under controlled conditions
Purifying the expressed protein using chromatographic techniques
The resulting recombinant protein is commonly stored in Tris-based buffer with 50% glycerol to maintain stability, and storage at -20°C or -80°C is recommended for extended preservation .
Recombinant Vibrio harveyi ATP synthase subunit a 1 has several important applications in scientific research:
Structural Studies: The purified protein can be used for X-ray crystallography or cryo-electron microscopy to determine its three-dimensional structure, providing insights into the mechanism of proton translocation.
Functional Assays: In-gel ATPase activity assays can be performed to study the catalytic activity of the ATP synthase complex. Studies with ATP synthases from other organisms have shown that the highest activity is often detected in the presence of mild detergents such as LDAO, while harsher detergents can significantly reduce activity .
Antibacterial Research: As ATP synthase is essential for bacterial survival, understanding its structure and function can aid in the development of new antibacterial compounds. Some studies have explored the susceptibility of various Vibrio species to antibacterial agents, which may indirectly affect ATP synthase function .
Functional differences between ATP synthases from different bacterial species often relate to adaptations to specific environmental conditions. Vibrio harveyi is a marine bacterium that can thrive in various environments, which may influence the specific properties of its ATP synthase components.
The activity of ATP synthases can be affected by various factors, including pH, temperature, and the presence of detergents or other compounds. Studies with other bacterial ATP synthases have shown that pretreatment with different detergents can significantly affect their ATP hydrolysis activity . Similar investigations with the V. harveyi enzyme could reveal specific functional adaptations.
An intriguing area for future research involves exploring the potential relationship between ATP synthesis and quorum sensing in Vibrio harveyi. V. harveyi utilizes a complex quorum sensing system involving multiple autoinducers (HAI-1, AI-2, and CAI-1) that regulate various processes including bioluminescence, biofilm formation, and proteolysis . The energy requirements for these processes are met, in part, by ATP generated through the ATP synthase complex, including the atpB1 component.
Another promising research direction concerns the potential role of ATP synthase in antimicrobial resistance. Studies have identified antibacterial components effective against various Vibrio species, including V. harveyi . Understanding how these compounds affect ATP synthase function, particularly the subunit a 1, could provide insights into mechanisms of antibacterial action and resistance.
KEGG: vca:M892_10605
STRING: 338187.VIBHAR_00428
ATP synthase subunit a 1 is a critical component of the F0 sector of ATP synthase in Vibrio harveyi. The protein is encoded by the atpB1 gene (locus name: VIBHAR_00428) and consists of 270 amino acids in its full-length form . This membrane-embedded subunit plays an essential role in proton translocation across the membrane, which drives the rotational mechanism necessary for ATP synthesis. The protein is classified as part of the F-ATPase family, specifically functioning as a subunit 6 component that contributes to the proton channel formation across the bacterial membrane .
Vibrio harveyi possesses two distinct ATP synthase a subunits, with atpB1 (270 amino acids) being longer than atpB2 (255 amino acids). The amino acid sequence alignment reveals key structural differences, particularly in the N-terminal region where atpB1 begins with "MAAPGEALTSSGY..." while atpB2 starts with "METVQSAHEYIEH..." . These proteins also differ in their UniProt accession numbers (A7N0Y8 for atpB1 and A7N2U2 for atpB2) and genomic locations (VIBHAR_00428 for atpB1 and VIBHAR_06110 for atpB2) . These differences suggest potential functional specialization, with each subunit potentially operating under different physiological conditions or contributing to distinct aspects of Vibrio harveyi energy metabolism.
The atpB1 protein consists primarily of hydrophobic transmembrane helices that form the proton channel within the F0 sector of ATP synthase. Key structural features include multiple membrane-spanning domains with specifically positioned charged residues that facilitate proton movement. The full amino acid sequence (MAAPGEALTSSGYIAHHLSNLSLAKLGLVADEASFWNVHIDSLFFSWFTGLIFLGIFYKV AKRTTAGVPGKLQCAVEMIVEFVAENVKDTFHGRNPLIAPLALTIFCWVFLMNVMDLVPI DFLPYPAEHWLGIPYLKVVPSADVNITMAMALGVFALMIYYSIKVKGLGGFAKELALHPF NHPLMIPFNLLIEVVSLLAKPISLGMRLFGNMFAGEVVFILCAAMLPWYLQWMGSLPWAI FHILVITIQA FVFMMLTIVYLSMAHEDSDH) reveals a predominance of hydrophobic residues consistent with its membrane localization .
For optimal expression of functional recombinant atpB1, E. coli-based expression systems utilizing specialized membrane protein vectors are recommended. The protein should be expressed with fusion tags that aid solubility without disrupting the native conformation. Given the hydrophobic nature of atpB1, expression protocols should incorporate membrane-mimetic environments during purification. Based on studies with similar membrane proteins from Vibrio species, the most successful expression has been achieved using specialized E. coli strains like C41(DE3) or C43(DE3) that are engineered for membrane protein expression . Temperature reduction during induction (to 18-20°C) and addition of glycerol (5-10%) to the culture medium can significantly improve the yield of properly folded recombinant atpB1.
Functional assessment of purified recombinant atpB1 requires multiple complementary approaches. Researchers should implement ATP hydrolysis assays using reconstituted proteoliposomes containing purified atpB1 alongside other F0F1 subunits. Proton translocation can be measured using pH-sensitive fluorescent dyes like ACMA (9-amino-6-chloro-2-methoxyacridine). Additionally, thermal shift assays can evaluate protein stability, while circular dichroism spectroscopy can confirm proper secondary structure composition. Importantly, researchers should verify the protein's ability to associate with other ATP synthase subunits through co-immunoprecipitation assays or analytical gel filtration techniques. Due to the critical importance of proper membrane insertion, the orientation of reconstituted atpB1 in artificial membranes should be verified using antibody-based assays targeting exposed epitopes.
Site-directed mutagenesis strategies for atpB1 should target conserved charged residues within transmembrane domains that are potentially involved in proton translocation. Based on structural homology with other F-type ATP synthases, researchers should focus on arginine residues in position 210-230 and acidic residues in the middle of transmembrane helices. The QuikChange mutagenesis method is appropriate for creating point mutations, while Gibson Assembly can be employed for segment replacements or chimeric constructs. Functional impact of mutations should be assessed through complementation studies in ATP synthase-deficient bacterial strains, membrane potential measurements, and ATP synthesis/hydrolysis assays. Creating a comprehensive alanine-scanning library of the transmembrane domains would provide valuable insights into structure-function relationships in this protein.
The optimal storage conditions for recombinant atpB1 protein require careful attention to prevent functional deterioration. The protein should be stored in a Tris-based buffer with 50% glycerol at -20°C for routine storage, or at -80°C for extended preservation . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles must be strictly avoided as they significantly compromise protein integrity . For long-term studies, researchers should prepare single-use aliquots in the presence of stabilizing agents such as specific lipids or detergents that maintain the native membrane environment. The storage buffer pH should be maintained between 7.5-8.0, which aligns with the optimal pH range for ATP synthase activity in Vibrio species . Additionally, inclusion of reducing agents like DTT or β-mercaptoethanol at low concentrations can prevent disulfide bond formation and oxidative damage.
For functional reconstitution of atpB1, researchers should employ a stepwise protocol beginning with detergent solubilization followed by incorporation into liposomes or nanodiscs. Effective detergents include n-dodecyl-β-D-maltoside (DDM) or digitonin at concentrations just above their critical micelle concentration. For liposome reconstitution, a mixture of phosphatidylcholine, phosphatidylethanolamine, and cardiolipin in ratios of 7:2:1 has been shown to support ATP synthase function in bacterial systems. The protein-to-lipid ratio should be optimized, typically starting at 1:100 (w/w). The removal of detergent can be achieved using Bio-Beads SM-2 or through dialysis, with the rate of detergent removal significantly impacting the final orientation and functionality of the reconstituted protein. For nanodisc reconstitution, MSP1D1 scaffold protein has shown good results with membrane proteins of similar size to atpB1.
To effectively compare the functions of atpB1 and atpB2, researchers should implement a multifaceted approach combining genetic, biochemical, and physiological methods. Gene knockout or CRISPR interference (CRISPRi) systems can be developed to selectively suppress each gene independently, followed by phenotypic characterization under various growth conditions. Expression patterns of both genes should be monitored using qRT-PCR across different growth phases and environmental conditions (pH, salinity, temperature, oxygen levels). Recombinant proteins of both subunits should be expressed, purified, and subjected to comparative biochemical analyses including proton translocation efficiency, ATP synthesis rates, and inhibitor sensitivity. Cross-complementation studies, where atpB1 is expressed in atpB2-deficient strains and vice versa, can reveal functional redundancy or specialization. Additionally, protein-protein interaction studies using techniques like bacterial two-hybrid systems or co-immunoprecipitation can identify differential interactions with other ATP synthase components.
When interpreting differences in ATP synthesis activity between wild-type and recombinant atpB1, researchers must consider multiple factors that could impact functional performance. Lower activity in recombinant systems may result from improper folding, incomplete assembly with other ATP synthase subunits, or absence of post-translational modifications present in native systems. Researchers should establish baseline comparisons using purified membrane fractions from wild-type Vibrio harveyi alongside reconstituted systems containing recombinant atpB1. Activity measurements should be normalized to protein concentration and conducted under identical conditions (pH, temperature, ionic strength). Statistical analysis using paired t-tests or ANOVA should be applied to determine significance of observed differences. Additionally, kinetic parameters (Km, Vmax) should be determined for both systems to identify specific aspects of function that may be altered in the recombinant protein.
Comprehensive bioinformatic analysis of atpB1 evolutionary conservation should begin with multiple sequence alignment of homologs across diverse bacterial species, particularly within the Vibrionaceae family. Tools like MUSCLE or CLUSTALW are appropriate for initial alignments, followed by phylogenetic tree construction using maximum likelihood or Bayesian methods. Conservation analysis should identify invariant residues that likely play critical functional or structural roles. Comparative analysis between atpB1 and atpB2 across species can reveal specialization patterns and potential horizontal gene transfer events. Protein domain prediction tools can identify conserved functional motifs, while transmembrane topology prediction algorithms (TMHMM, TOPCONS) can compare predicted membrane-spanning regions across homologs. Codon usage analysis and selection pressure calculations (dN/dS ratios) can provide insights into evolutionary constraints acting on different regions of the gene. Network analysis of co-evolving residues can identify functionally coupled amino acid positions that maintain protein structure and function.
Integrating structural and functional data for comprehensive modeling of atpB1 activity requires a multidisciplinary approach. Researchers should begin by generating homology models based on crystal structures of ATP synthase subunit a from related organisms, then refine these models using molecular dynamics simulations in membrane environments. Functional data from mutagenesis studies should be mapped onto structural models to identify critical residues and their spatial relationships. Cryo-EM studies of the complete ATP synthase complex can provide context for the interactions between atpB1 and other subunits. Proton translocation pathways can be predicted using computational approaches like Monte Carlo simulations or constant-pH molecular dynamics. Integration of biochemical data (pH-dependent activity, inhibitor binding) with structural models can validate predicted functional mechanisms. These comprehensive models should be iteratively refined as new experimental data becomes available, with particular attention to the dynamic aspects of protein function during the catalytic cycle.
ATP synthase subunit a 1 (atpB1) in Vibrio harveyi shows distinct characteristics when compared to homologous proteins in other bioluminescent bacteria. While Vibrio fischeri possesses similar acyl-ACP synthetase activity that may interact with energy metabolism pathways, such activity is notably absent in Photobacterium phosphoreum . This suggests divergent evolution of energy coupling mechanisms among bioluminescent bacteria. When examining ATP synthesis mechanisms across these species, researchers should focus on how variations in the proton channel components like atpB1 may be adapted to support the high energy demands of the bioluminescence process. Research indicates potential specialized roles for ATP synthase components in bioluminescent bacteria that may be linked to the unique metabolic requirements of light production, particularly in managing energy distribution between growth and luminescence.
The presence of two distinct ATP synthase a subunits (atpB1 and atpB2) in Vibrio harveyi suggests potential adaptation to varying environmental conditions. These different subunits may be differentially expressed or activated under specific growth conditions, such as changes in pH, salinity, or oxygen availability. Research protocols should include growth studies under various environmental conditions with real-time monitoring of atpB1 and atpB2 expression levels. The cytosolic nature of certain Vibrio harveyi enzymes, unlike membrane-bound equivalents in E. coli, suggests specialized metabolic adaptations that may extend to ATP synthase components . Researchers should investigate whether atpB1 expression correlates with specific stress responses or growth phases, and determine if its regulation is coordinated with other bioenergetic systems. Differential expression analysis using RNA-seq under various environmental conditions would provide valuable insights into the ecological role of atpB1.
When designing experiments with recombinant Vibrio harveyi ATP synthase subunit a 1 (atpB1), researchers must prioritize protein stability and functional integrity. The hydrophobic nature of this membrane protein requires careful handling with appropriate detergents and lipid environments to maintain native structure. Proper storage conditions (-20°C to -80°C in 50% glycerol buffer) are essential, and repeated freeze-thaw cycles must be avoided . Functional assays should incorporate controls that verify proper folding and membrane insertion. When comparing results across studies, researchers should standardize expression systems, purification methods, and reconstitution protocols to ensure reproducibility. Given the protein's role in the multisubunit ATP synthase complex, interaction studies should be included to verify proper association with partner subunits. Finally, researchers should establish clear functional benchmarks against which modified or mutant versions of atpB1 can be compared.