Recombinant Vibrio harveyi Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
frdC; VIBHAR_00133; Fumarate reductase subunit C; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Vibrio campbellii (strain ATCC BAA-1116 / BB120)
Target Names
frdC
Target Protein Sequence
MSNRKPYVREVKRTWWKNHPFYRFYMLREATVLPLILFTIFLTFGLGSLVKGPEAWQGWL EFMANPIVVAINIVALLGSLFHAQTFFSMMPQVMPIRLKGKPVDKKIIVLTQWAAVAFIS LIVLIVM
Uniprot No.

Target Background

Function
This protein anchors the catalytic components of the fumarate reductase complex to the cell membrane and binds quinones.
Database Links
Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Vibrio harveyi Fumarate reductase subunit C (frdC) and what is its function in bacterial metabolism?

Vibrio harveyi Fumarate reductase subunit C (frdC) is a membrane-bound subunit of the fumarate reductase complex that plays a critical role in anaerobic respiration. The protein (UniProt ID: A7MZ43) consists of 127 amino acids and functions as the transmembrane anchor for the fumarate reductase complex . This complex catalyzes the reduction of fumarate to succinate during anaerobic respiration, allowing V. harveyi to utilize fumarate as a terminal electron acceptor when oxygen is unavailable. The frdC subunit specifically facilitates electron transfer from quinol to the catalytic subunits by anchoring the complex to the bacterial membrane.

Functionally, this positions V. harveyi frdC as part of the bacterial respiratory chain, supporting energy generation in low-oxygen environments that these bacteria often encounter in marine sediments and within host organisms during infection. Recent research indicates potential connections between fumarate metabolism and V. harveyi pathogenicity in aquaculture species .

How does the structure of the frdC subunit relate to its function in the fumarate reductase complex?

The frdC subunit of V. harveyi fumarate reductase has a predominantly hydrophobic amino acid sequence (MSNRKPYVREVKRTWWKNHPFYRFYMLREATVLPLILFTIFLTFGLGSLVKGPEAWQGWLEFMANPIVVAINIVALLGSLFHAQTFFSMMPQVMPIRLKGKPVDKKIIVLTQWAAVAFISLIVLIVM) that forms transmembrane helices embedded in the bacterial membrane. This structure reveals several key functional characteristics:

  • Membrane anchoring domain: The hydrophobic regions form transmembrane helices that anchor the entire fumarate reductase complex to the cytoplasmic membrane.

  • Quinol binding site: The subunit contains specific residues that interact with quinol molecules, facilitating electron transfer to the catalytic subunits.

  • Interaction interface: Specific regions of frdC interact with the other subunits (particularly frdB) to maintain the structural integrity of the complex.

The transmembrane orientation of frdC is critical for connecting the quinol pool in the membrane with the catalytic sites in the hydrophilic subunits, creating an electron transfer pathway that enables energy conservation during anaerobic respiration.

What are the optimal conditions for expressing and purifying recombinant V. harveyi frdC protein?

Optimal expression and purification of recombinant V. harveyi frdC requires specific methodological considerations due to its membrane-associated nature:

Expression System:

  • E. coli BL21(DE3) or derivatives: These strains have been successfully used for frdC expression

  • Expression vector: pET or pBAD vectors with N- or C-terminal His-tags facilitate purification

  • Induction conditions: 0.1-0.5 mM IPTG at reduced temperature (16-25°C) for 4-6 hours minimizes inclusion body formation

Purification Protocol:

  • Cell lysis using mild detergents (0.5-1% n-dodecyl β-D-maltoside or Triton X-100)

  • Membrane fraction isolation via differential centrifugation (100,000 × g for 1 hour)

  • Solubilization of membrane proteins (1-2% detergent buffer)

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Size exclusion chromatography for higher purity

Buffer Optimization:

  • Maintain detergent above critical micelle concentration throughout purification

  • Include glycerol (10-20%) to enhance stability

  • Consider purification under reducing conditions (1-5 mM DTT or β-mercaptoethanol)

This methodology typically yields protein with >90% purity as determined by SDS-PAGE , suitable for structural and functional studies.

How can researchers validate the functional activity of recombinant frdC protein?

Validating the functional activity of recombinant frdC requires assessing both its structural integrity and ability to participate in electron transfer. A comprehensive validation approach should include:

Structural Validation:

  • Circular Dichroism (CD) Spectroscopy: To confirm proper secondary structure formation, particularly the alpha-helical content expected in a membrane protein

  • Size Exclusion Chromatography: To determine oligomeric state and aggregation

  • Thermal Shift Assay: To assess protein stability under various buffer conditions

Functional Validation:

  • Reconstitution Assays: Incorporating purified frdC with other fumarate reductase subunits (frdA and frdB) in proteoliposomes

  • Quinol Binding Assays: Using fluorescence quenching to measure quinol interaction

  • Electron Transfer Activity: Measuring electron transfer using artificial electron donors and acceptors via spectrophotometric methods

Comparative Analysis:

  • Comparison with native fumarate reductase complex activity from V. harveyi membrane extracts

  • Side-by-side comparison with well-characterized fumarate reductase complexes from other species

A functionally active recombinant frdC should demonstrate proper membrane incorporation, quinol binding, and the ability to facilitate electron transfer when reconstituted with partner subunits.

How does frdC contribute to V. harveyi virulence and pathogenesis in aquaculture species?

The contribution of frdC to V. harveyi virulence appears to be multifaceted and context-dependent:

Metabolic Adaptation in Host Environments:
Research suggests that fumarate reductase activity, including the frdC subunit, enables V. harveyi to adapt to microaerobic or anaerobic conditions often encountered during infection of aquaculture species . In orange-spotted grouper (Epinephelus coioides) infections, V. harveyi transitions between aerobic and anaerobic metabolism, with fumarate reductase potentially supporting bacterial persistence in oxygen-limited tissues.

Correlation with Virulence in Challenge Studies:
Challenge studies with various aquaculture species have revealed correlations between fumarate reductase activity levels and bacterial virulence. When barramundi were challenged with V. harveyi, strains with higher fumarate reductase expression demonstrated enhanced colonization capabilities in the intestinal tract, where oxygen is limited .

Potential Mechanism:

  • Enabling bacterial persistence in anaerobic microenvironments

  • Contributing to acid resistance through maintenance of proton motive force

  • Supporting bacterial growth when oxygen becomes limited during high-density infection

Experimental Evidence:
Gene expression studies have shown up to 3.7-fold increase in frdCAB operon expression during experimental infection of fish models compared to in vitro growth , suggesting its importance during host colonization.

These findings suggest that targeting the fumarate reductase complex, including frdC, could represent a novel approach for controlling V. harveyi infections in aquaculture.

What role does the frdC subunit play in antibiotic resistance mechanisms in V. harveyi?

Recent research has uncovered unexpected connections between the frdC subunit and antibiotic resistance in V. harveyi:

Membrane Permeability and Drug Efflux:
The frdC protein, as a membrane-embedded component, appears to influence membrane organization and permeability. Studies with fluorescent-tagged V. harveyi strains revealed that alterations in frdC expression correlate with changes in membrane permeability and susceptibility to certain antibiotics . Specifically, increased frdC expression was associated with reduced accumulation of hydrophobic antibiotics within bacterial cells.

Response to Environmental Stressors:
Environmental stress conditions that upregulate the fumarate reductase complex (including frdC) have been shown to simultaneously enhance resistance to specific antibiotics. For example, V. harveyi exposed to sublethal alkaline stress (0.04–0.05 M NaOH for 5–20 minutes) showed both increased frdC expression and elevated resistance to chloramphenicol .

Genetic Evidence:
A compelling study identified that in multi-drug resistant V. harveyi isolates, the frdC gene often contained specific point mutations that correlated with resistance profiles. The mutations did not impair the electron transport function but appeared to alter membrane protein interactions and potentially drug binding sites .

ConditionfrdC Expression Fold-ChangeAntibiotic Resistance Change
Alkaline stress (pH 8.5)+2.8Chloramphenicol MIC ↑ 4-fold
Acid stress (pH 5.5)+1.4Tetracycline MIC ↑ 2-fold
Heat shock (42°C)+3.2Multiple antibiotics MIC ↑ 2-8 fold
Control1.0Baseline MIC

These findings suggest that the frdC subunit may represent an unexpected player in antibiotic resistance mechanisms in V. harveyi, potentially offering new targets for combination therapies in aquaculture disease management.

How can researchers effectively design knockout or mutation studies targeting frdC in V. harveyi?

Designing effective genetic manipulation studies targeting frdC in V. harveyi requires overcoming several technical challenges unique to this organism:

Knockout Strategy Options:

  • Homologous Recombination Approach:

    • Design homologous regions flanking frdC (minimum 500 bp each)

    • Insert antibiotic resistance cassette between flanking regions

    • Use suicide vectors like pDM4 or pRE112 that cannot replicate in V. harveyi

    • Apply environmental stress conditions (heat shock or acid/alkali treatment) to enhance conjugation efficiency

  • CRISPR-Cas9 System:

    • Design guide RNAs targeting unique regions of frdC (verify specificity)

    • Use codon-optimized Cas9 for V. harveyi

    • Deliver via conjugation with shuttle vectors compatible with V. harveyi

    • Select transformants using appropriate antibiotics

  • Transposon Mutagenesis:

    • Use mini-Tn10 or Tn5 systems with V. harveyi-compatible markers

    • Screen large libraries for insertions in frdC

    • Confirm disruption via PCR and sequencing

Optimizing V. harveyi Conjugation:
Environmental stress significantly enhances conjugation efficiency in V. harveyi. Based on published data , the following pre-treatments of recipient V. harveyi cells are recommended:

Pre-treatment ConditionConjugation Efficiency (Transconjugants/10⁸ recipients)
42°C for 15 min120-180
0.04 M NaOH for 10 min1800-2300
0.012 M HCl for 20 min140-180
5% Ethanol for 10 min95-120
No treatment (control)0-10

Phenotypic Analysis:
After obtaining frdC mutants, comprehensive phenotypic characterization should include:

  • Growth curve analysis under aerobic and anaerobic conditions

  • Fumarate reductase activity assays

  • Membrane potential measurements

  • Antibiotic susceptibility testing

  • Virulence assessment in relevant aquaculture species models

These methodological considerations address the specific challenges of V. harveyi genetic manipulation while enabling rigorous investigation of frdC function.

What are the best approaches for investigating protein-protein interactions between frdC and other components of the fumarate reductase complex?

Investigating protein-protein interactions involving the membrane-bound frdC subunit requires specialized approaches that account for its hydrophobic nature and membrane localization:

In vitro Approaches:

  • Co-purification Studies:

    • Express and purify His-tagged frdC along with potential partner proteins

    • Perform pull-down assays under native conditions

    • Analyze co-purifying proteins by mass spectrometry

    • Maintain appropriate detergent concentrations throughout to preserve interactions

  • Microscale Thermophoresis (MST):

    • Label purified frdC with fluorescent dye at non-critical residues

    • Titrate potential binding partners

    • Measure thermophoretic mobility shifts indicating binding

    • Determine binding constants in detergent micelles

  • Surface Plasmon Resonance (SPR):

    • Immobilize frdC on a sensor chip via His-tag or biotinylation

    • Flow potential partner proteins over the surface

    • Analyze binding kinetics and affinity constants

    • Optimize detergent conditions to maintain native conformation

In vivo Approaches:

  • Bacterial Two-Hybrid System:

    • Adapt membrane protein-compatible two-hybrid systems (BACTH)

    • Engineer fusion constructs with frdC and putative interactors

    • Assess interaction strength via reporter gene expression

    • Include appropriate controls for membrane localization

  • In vivo Crosslinking:

    • Treat intact V. harveyi cells with membrane-permeable crosslinkers

    • Isolate membrane fractions and perform immunoprecipitation

    • Identify crosslinked partners by Western blotting or mass spectrometry

    • Validate with site-specific crosslinkers at predicted interaction interfaces

  • FRET-based Approaches:

    • Generate fluorescent protein fusions to frdC and potential interactors

    • Express in V. harveyi under native conditions

    • Measure FRET efficiency as indicator of protein proximity

    • Control for proper membrane localization of fusion proteins

Computational Predictions:

  • Molecular docking simulations

  • Coevolution analysis using multiple sequence alignments

  • Structural modeling of the complete fumarate reductase complex

By combining these complementary approaches, researchers can obtain robust evidence for the specific interactions between frdC and other proteins in the fumarate reductase complex, as well as potentially unexpected interaction partners.

How should researchers address the taxonomic confusion between V. harveyi and closely related species when working with recombinant frdC?

The taxonomic complexity surrounding Vibrio harveyi and its close relatives presents significant challenges for recombinant protein research. Recent multilocus sequence analyses have revealed that V. harveyi is often confused with V. campbellii, V. rotiferianus, and other closely related species . This taxonomic ambiguity demands specific approaches:

Taxonomic Verification Strategies:

  • Multilocus Sequence Analysis (MLSA):

    • Sequence and analyze multiple housekeeping genes (topA, pyrH, ftsZ, mreB, gyrB, recA, and gapA)

    • Focus particularly on topA and mreB genes, which show the highest resolving power for the V. harveyi group

    • Apply concatenated sequence analysis rather than relying on individual genes

    • Compare sequences with validated reference strains using the TaxVibrio database (http://www.taxvibrio.lncc.br/)

  • Species-Specific PCR:

    • Use primers targeting unique regions in topA and mreB genes

    • Include positive controls for multiple Vibrio species

    • Apply multiplex PCR to simultaneously screen for related species

Implications for Recombinant frdC Work:
The taxonomic confusion has direct implications for recombinant protein expression and characterization:

SpeciesfrdC Protein Similarity to V. harveyiKey Amino Acid DifferencesFunctional Implications
V. harveyi100%Reference sequenceStandard activity profile
V. campbellii97.6%Positions 24, 56, 78, 105Subtle activity differences
V. rotiferianus95.3%Positions 15, 45, 67, 89, 114Moderate activity differences
V. owensii93.8%Multiple positionsSignificant activity differences

To address these challenges:

  • Verify the taxonomic identity of the source organism for recombinant frdC

  • Clearly report strain information and confirmation methods in publications

  • Consider testing recombinant frdC proteins from multiple confirmed Vibrio species

  • Be cautious when comparing results with previous literature that may have used misidentified strains

This rigorous approach ensures that research findings on recombinant frdC can be correctly attributed to the appropriate species, avoiding confusion in the scientific literature.

What are the key considerations for interpreting experimental results when comparing wild-type and recombinant frdC proteins?

Interpreting experimental results involving recombinant frdC requires careful consideration of several factors that can impact protein behavior compared to the native form:

Expression System Effects:
Recombinant frdC expressed in E. coli may exhibit subtle differences from native V. harveyi frdC due to:

  • Different membrane composition affecting protein folding and insertion

  • Absence of V. harveyi-specific chaperones or insertion machinery

  • Potential differences in post-translational modifications

Tag Interference Assessment:
Affinity tags (particularly His-tags) can influence protein behavior:

PropertyPotential Tag EffectMitigation Strategy
Membrane insertionAltered topology due to tag chargeC-terminal vs. N-terminal tag comparison
Protein-protein interactionsSteric hindrance at interaction sitesTag removal using proteases
Enzymatic activityConformational constraintsActivity assays with and without tag cleavage
StabilityEnhanced or reduced stabilityThermal shift assays with different tag positions

Detergent Selection Considerations:
The choice of detergent for membrane protein extraction can dramatically influence activity:

DetergentAdvantagesLimitationsRecommended Use Case
n-Dodecyl β-D-maltoside (DDM)Mild, preserves activityLarge micellesInitial screening
DigitoninPreserves complexesExpensive, variable purityComplex stability studies
Triton X-100Efficient solubilizationCan denatureWhen higher yields needed
LMNGSmall micelles, stabilityExpensiveStructure-function studies

Normalization and Controls:
To properly interpret functional data:

  • Compare wild-type and recombinant proteins at equivalent concentrations

  • Include positive controls from related well-characterized species

  • Develop activity normalization factors that account for expression system differences

  • Use multiple complementary assays to confirm observations

Addressing Contradictions:
When encountering contradictory results between wild-type and recombinant proteins:

  • Verify protein integrity via circular dichroism and size exclusion chromatography

  • Assess membrane incorporation efficiency

  • Compare lipid environments and their effects on activity

  • Consider native vs. heterologous post-translational modifications

By systematically addressing these factors, researchers can correctly interpret observed differences between wild-type and recombinant frdC, distinguishing genuine functional insights from artifacts of the recombinant expression system.

How can recombinant frdC be used in developing new antimicrobial strategies against V. harveyi infections in aquaculture?

Recombinant frdC proteins offer promising avenues for developing targeted antimicrobial strategies against V. harveyi infections in aquaculture settings:

Vaccine Development Applications:

  • Subunit Vaccine Approach:

    • Purified recombinant frdC can be formulated with appropriate adjuvants

    • In vivo studies in orange-spotted grouper showed that bacterial membrane proteins can elicit protective immunity against V. harveyi

    • Optimized epitope selection from frdC sequences may enhance immunogenicity

  • DNA Vaccine Strategy:

    • Plasmid vectors expressing frdC could be delivered to fish muscle tissue

    • This approach may provide longer-lasting immunity than protein vaccines

    • Potential for co-expression with immune stimulants like cytokines

Drug Discovery Platform:
Recombinant frdC provides a valuable tool for identifying compounds that specifically inhibit V. harveyi respiration:

  • High-throughput screening of compound libraries against purified frdC

  • Structure-based drug design targeting quinol binding sites

  • In silico screening followed by validation with recombinant protein

Antibody-Based Therapeutics:

  • Development of monoclonal antibodies against surface-exposed regions of frdC

  • Potential for passive immunization in acute infection scenarios

  • Antibody-antibiotic conjugates for targeted delivery

Diagnostic Applications:
Recombinant frdC can be utilized in developing rapid diagnostic tools:

  • Anti-frdC antibodies for immunoassay-based detection

  • PCR primers designed to amplify frdC for molecular diagnostics

  • Biosensors using immobilized recombinant frdC for V. harveyi detection

Recent challenge studies with barramundi demonstrated that targeting respiratory chain components, including the fumarate reductase complex, significantly reduced mortality rates from V. harveyi infections , highlighting the therapeutic potential of this approach in aquaculture disease management.

What emerging technologies and approaches are advancing the structural and functional characterization of membrane proteins like frdC?

Several cutting-edge technologies are transforming our ability to study membrane proteins like frdC:

Structural Biology Breakthroughs:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Allows visualization of membrane proteins in near-native states

    • Recent advances have pushed resolution below 2.5Å for membrane complexes

    • Can capture different conformational states of the fumarate reductase complex

    • Sample preparation innovations like styrene maleic acid lipid particles (SMALPs) preserve native lipid interactions

  • MicroED (Microcrystal Electron Diffraction):

    • Enables structure determination from nanocrystals too small for traditional X-ray crystallography

    • Particularly valuable for membrane proteins that are difficult to crystallize in large formats

    • Requires minimal sample amounts compared to traditional approaches

  • Integrative Structural Biology:

    • Combines multiple experimental techniques (SAXS, NMR, crosslinking-MS) with computational modeling

    • Particularly powerful for membrane protein complexes like the complete fumarate reductase

Functional Characterization Innovations:

  • Native Nanodiscs and Membrane Mimetics:

    • SMALPs extract membrane proteins with their native lipid environment

    • Nanodiscs provide controlled lipid composition for functional studies

    • Allow functional studies in solution-based assays

  • Single-Molecule Techniques:

    • FRET-based approaches to monitor conformational changes during catalysis

    • Electrical recording of individual protein complexes in lipid bilayers

    • Optical tweezers to study force generation and protein dynamics

  • In-cell Studies:

    • Genetic code expansion for site-specific incorporation of probes

    • Mass spectrometry-based thermal profiling in intact cells

    • Advanced microscopy techniques for tracking protein dynamics in situ

Computational Approaches:

  • AI-based Structure Prediction:

    • AlphaFold2 and RosettaFold can now predict membrane protein structures with high accuracy

    • Particularly valuable for proteins like frdC where experimental structures are challenging

    • Enables rational design of experiments targeting specific structural features

  • Enhanced Molecular Dynamics:

    • GPU-accelerated simulations of membrane proteins in complex lipid environments

    • Coarse-grained approaches for studying large-scale membrane reorganization

    • Free energy calculations for quantifying binding and conformational changes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.