Recombinant Vibrio harveyi Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant frdD

Recombinant Vibrio harveyi fumarate reductase subunit D (frdD) is a transmembrane protein engineered for laboratory use through heterologous expression systems. It originates from Vibrio harveyi (strain ATCC BAA-1116 / BB120) and is part of the bacterial fumarate reductase complex, which facilitates anaerobic respiration by catalyzing the reduction of fumarate to succinate . The recombinant form includes an N-terminal 10×His-tag for purification and is produced in E. coli .

Functional Role

frdD is a component of the fumarate reductase complex, which enables Vibrio harveyi to respire anaerobically by transferring electrons to fumarate. This complex is critical for maintaining redox balance in oxygen-limited environments . While the exact catalytic role of frdD remains under investigation, its transmembrane structure suggests involvement in anchoring the enzyme to the bacterial membrane or facilitating electron transfer .

ELISA and Immunological Studies

Recombinant frdD is commercially available for use in enzyme-linked immunosorbent assays (ELISA), enabling the detection of antibodies against Vibrio harveyi antigens . This application underscores its utility in diagnostic and serological research.

Biochemical Context

The fumarate reductase complex in Vibrio species is distinct from the acrylate reductase (ARD) enzyme, which reduces acrylate in a NADH-dependent manner . While ARD (GenBank ID: AIV07243) shares structural similarities with fumarate reductases, it lacks conserved residues critical for fumarate binding, such as histidine in motif II and arginine in motif III . This divergence highlights the functional specialization of frdD in fumarate metabolism.

Comparative Analysis with Related Proteins

FeaturefrdD (Fumarate Reductase)ARD (Acrylate Reductase)
SubstrateFumarateAcrylate
Catalytic DomainsFAD_binding_2OYE-like, FMN_bind, FAD_binding_2
Flavin CofactorsNon-covalently bound FAD/FMN (ratio 1:1:1)Covalently bound FMN, FAD, FMN (1:1:1)
Key MotifsConservation of arginine residues in motifs I/IIIReplacement of histidine (motif II) with methionine
Primary FunctionAnaerobic respiration via fumarateAcrylate detoxification and energy recovery

Data synthesized from .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
frdD; VIBHAR_00134; Fumarate reductase subunit D; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-125
Protein Length
full length protein
Species
Vibrio campbellii (strain ATCC BAA-1116 / BB120)
Target Names
frdD
Target Protein Sequence
MKPNYSVNTAPKRSDEPIWWGLFGAGGTWFAMITPITVLVLGILVPLGVIDAEAMSYERV SEFATSIIGALFIIGTLALPMWHAMHRVHHGMHDLKFHTGVVGKIACYAFAGLISALAVV FIFMI
Uniprot No.

Target Background

Function
Anchors the catalytic components of the fumarate reductase complex to the cell membrane and binds quinones.
Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Vibrio harveyi fumarate reductase and what is its role in bacterial metabolism?

Fumarate reductase in bacteria like Vibrio harveyi functions as an alternative terminal electron acceptor during oxygen deficiency, enabling NADH regeneration. In many bacteria, the cytoplasmic fumarate reductase contains the FAD_binding_2 domain, which is critical for its reduction activity . This enzyme allows bacteria to continue energy production during anaerobic conditions by catalyzing the reduction of fumarate to succinate. The variability in the primary structure of FAD_binding_2 domains among homologous proteins suggests the existence of different substrate specificities among these enzymes .

How does the domain structure of Vibrio harveyi fumarate reductase differ from related oxidoreductases?

Vibrio harveyi contains proteins with FAD_binding_2 domains that differ from typical fumarate reductases. For example, the recently characterized acrylate reductase (ARD) contains OYE-like, FMN_bind, and FAD_binding_2 domains . While sharing domain composition with Klebsiella pneumoniae NADH:fumarate oxidoreductase, the V. harveyi enzyme differs significantly in key motifs. Specifically, the histidine residue of Motif II is replaced by methionine, and only one arginine residue is conserved in Motif III compared to fumarate reductase sequences . These structural differences correlate with distinct substrate specificity.

What expression systems are most effective for recombinant production of Vibrio harveyi oxidoreductases?

For recombinant production of V. harveyi oxidoreductases like ARD, pBAD-TOPO vector systems with C-terminal 6His tags have proven effective . This approach facilitates protein purification while maintaining enzymatic activity. When expressing V. harveyi oxidoreductases, it's important to consider that some may contain covalently bound flavin mononucleotide (FMN) requiring the specific flavin transferase ApbE for attachment . Expression systems should therefore accommodate the co-expression of necessary auxiliary proteins if required for proper enzyme assembly and function.

What safety considerations should be addressed when working with recombinant Vibrio harveyi proteins?

When working with recombinant V. harveyi proteins, researchers should follow established biosafety guidelines for recombinant DNA work. Although V. harveyi is generally not considered highly pathogenic to humans, some strains can be virulent in marine environments and aquaculture settings . Current biosafety protocols derived from the historic Asilomar Conference recommendations include working under appropriate containment conditions and preventing the spread of recombinant DNA molecules . Particularly when working with genes from potentially pathogenic strains, researchers should be aware that V. harveyi contains multiple plasmids that may carry virulence factors .

How can researchers distinguish between fumarate reductase activity and other oxidoreductase activities in Vibrio harveyi?

To distinguish between fumarate reductase and other oxidoreductase activities in V. harveyi, researchers should implement a comprehensive enzymatic characterization protocol. Based on published methodologies, this should include:
Substrate Specificity Analysis:

SubstrateTypical Km (mM) for FRDTypical Km (mM) for ARDNotes
Fumarate0.01-0.1>10Poor ARD activity against fumarate
AcrylatePoor activity0.086 ± 0.010High specificity of ARD
MethacrylatePoor activity8.4 ± 1.1Lower ARD efficiency vs. acrylate
Other α,β-unsaturated carboxylic acidsVariableVariableTest panel recommended
Researchers should measure initial reaction rates at varying substrate concentrations using NADH oxidation assays (typically monitoring absorbance at 340 nm). The catalytic efficiency (kcat/Km) values will help definitively differentiate between enzyme activities . For example, ARD shows 330-fold higher catalytic efficiency with acrylate compared to methacrylate, while known methacrylate reductases do not reduce acrylate or reduce it at much lower rates .

What structural features determine substrate specificity in Vibrio harveyi oxidoreductases with FAD_binding_2 domains?

The substrate specificity of V. harveyi oxidoreductases with FAD_binding_2 domains is determined by key amino acid residues in three conserved motifs. Based on structural and functional analyses:

  • Motif I - Contains a conserved arginine residue that interacts with the carboxyl group of the substrate in both fumarate reductases and acrylate reductases .

  • Motif II - Critical for substrate discrimination:

    • Fumarate reductases contain a conserved histidine residue

    • Acrylate reductase (ARD) has this histidine replaced by methionine

    • The conserved threonine residue (e.g., Thr808 in ARD) appears important for maintaining some activity against bulkier substrates like fumarate

  • Motif III - In ARD, only one arginine residue (affiliated with both Motifs I and III) is conserved compared to fumarate reductase sequences
    These specific amino acid substitutions in critical motifs result in dramatic changes in substrate preference, as evidenced by the exclusive specificity of ARD for acrylate over fumarate despite their structural similarities .

How does gene expression of Vibrio harveyi oxidoreductases respond to environmental conditions?

V. harveyi oxidoreductases show complex gene expression patterns in response to environmental conditions, particularly oxygen availability and substrate presence:
Expression Response of ARD to Environmental Conditions:

ConditionRelative Expression LevelFold-Increase with AcrylateNotes
AerobicLow (baseline)Dramatic increaseAcrylate is a potent inducer
AnaerobicHigher than aerobic baseline~2-fold increaseLess dramatic response to acrylate
Quantitative reverse transcription PCR (RT-qPCR) analysis revealed that acrylate dramatically stimulates ARD biosynthesis in aerobically grown V. harveyi cells. In contrast, the ard gene expression under anaerobic conditions is higher than in aerobic cultures even without acrylate, suggesting differential regulation based on oxygen availability .
This pattern suggests that the principal role of ARD in Vibrio is energy-saving detoxification of acrylate from the environment, with acrylate potentially serving as a terminal electron acceptor under anaerobic conditions or as a substrate in aerobic respiration .

What are the latest techniques for analyzing the flavin cofactors in recombinant Vibrio harveyi oxidoreductases?

Advanced analysis of flavin cofactors in V. harveyi oxidoreductases requires a multi-technique approach:

  • Fluorescence Spectroscopy - To detect and differentiate between flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD) based on characteristic emission spectra.

  • Absorption Spectroscopy - The ARD enzyme exhibits distinct peaks at 380 and 455 nm, characteristic of flavoproteins .

  • SDS-PAGE with UV Illumination - To detect covalently bound flavins, which remain fluorescent after SDS treatment.

  • Tryptic Digestion and Mass Spectrometry - As demonstrated with ARD, this technique can precisely identify the attachment site of covalently bound FMN. The analysis revealed that FMN is bound through a phosphoester bond to Thr165 in the FMN_bind domain of ARD .

  • Quantitative Analysis - The ratio of covalently bound FMN, non-covalently bound FAD, and non-covalently bound FMN in ARD was determined to be 1:1:1 .
    These techniques collectively enable comprehensive characterization of the flavin cofactor composition, which is essential for understanding the catalytic mechanism of these oxidoreductases.

How can researchers optimize experimental conditions for activity assays of recombinant Vibrio harveyi oxidoreductases?

Optimization of experimental conditions for activity assays of V. harveyi oxidoreductases should consider temperature, pH, and the physiological relevance of the conditions:
Key Parameters for Enzyme Activity Assays:

ParameterOptimal RangeConsiderations
Temperature22-34°CV. harveyi shows increased phenotypic activity at 28°C and 34°C compared to 22°C
pH7.0-8.0Marine bacteria typically prefer slightly alkaline conditions
Buffer50 mM potassium phosphateWith additional 0.1 M NaCl to mimic marine conditions
NADH0.1-0.2 mMMonitor at 340 nm for oxidation rate
Substrate0.01-10 mMRange should span well below and above Km
Additionally, researchers should be aware that temperature fluctuations associated with climate change may act as a stressor on bacteria, potentially increasing virulence gene expression and host adaptation . This environmental factor may also influence the expression and activity of metabolic enzymes like oxidoreductases.
For kinetic measurements, initial reaction rates should be determined from the linear portion of the reaction progress curve, typically within the first 2-3 minutes .

What common issues arise when expressing recombinant Vibrio harveyi oxidoreductases, and how can they be resolved?

Common issues and their solutions when expressing recombinant V. harveyi oxidoreductases include:

  • Insufficient Flavin Incorporation:

    • Problem: Sub-optimal activity due to incomplete flavin incorporation

    • Solution: Co-express the specific flavin transferase ApbE, which is required for covalent attachment of FMN to the FMN_bind domain . For ARD, the covalently bound FMN is absolutely required for activity .

  • Protein Solubility Issues:

    • Problem: Formation of inclusion bodies

    • Solution: Optimize growth temperature (try 18-25°C), use solubility-enhancing fusion tags, or co-express chaperones to assist in protein folding.

  • Low Yield:

    • Problem: Poor expression levels

    • Solution: Test different promoters (e.g., pBAD for tight regulation) , optimize codon usage for the expression host, and adjust induction conditions.

  • Protein Instability:

    • Problem: Rapid degradation of the recombinant protein

    • Solution: Include protease inhibitors during purification, optimize buffer conditions, and consider adding stabilizing agents like glycerol.

How can researchers verify that recombinantly expressed Vibrio harveyi oxidoreductases maintain native structural features?

To verify that recombinantly expressed V. harveyi oxidoreductases maintain native structural features, researchers should employ multiple analytical techniques:

  • Spectroscopic Analysis: Compare the absorption spectra of purified recombinant enzymes with those of native enzymes. Characteristic peaks at 380 and 455 nm indicate proper flavin incorporation .

  • Enzymatic Activity: Measure specific activity and compare kinetic parameters (Km, kcat, kcat/Km) with those of the native enzyme if available. For ARD, the Km for acrylate is approximately 0.086 mM .

  • Mass Spectrometry: Perform intact protein MS to confirm correct molecular weight and post-translational modifications, such as covalent attachment of FMN.

  • Circular Dichroism (CD): Use CD spectroscopy to assess secondary structure content and confirm proper protein folding.

  • Thermal Stability Assays: Methods like differential scanning fluorimetry can assess protein stability and proper folding.

  • Size Exclusion Chromatography: Verify the oligomeric state of the recombinant protein matches expectations based on known native protein structure.

How can recombinant Vibrio harveyi oxidoreductases be applied in bioremediation research?

Recombinant V. harveyi oxidoreductases, particularly acrylate reductase (ARD), have promising applications in bioremediation research:

  • Acrylate Detoxification: The discovery that ARD functions in energy-saving detoxification of acrylate from the environment suggests potential applications in bioremediation of acrylate-contaminated marine environments . Acrylate can be toxic to many organisms, and engineered systems expressing ARD could help remediate such contaminants.

  • Enzymatic Conversion of Industrial Waste: Recombinant ARD could be employed for the conversion of α,β-unsaturated carboxylic acids in industrial wastewater to less toxic reduced forms.

  • Biosensor Development: The high specificity of ARD for acrylate could be exploited to develop biosensors for detecting acrylate contamination in aquatic environments.

  • Anaerobic Digesters: The ability of these enzymes to function under anaerobic conditions suggests applications in anaerobic digesters for waste treatment.
    Research in these areas would require careful optimization of enzyme expression systems and stability in environmental applications, as well as assessment of the ecological impact of introducing recombinant organisms or enzymes.

What evolutionary insights can be gained from comparing Vibrio harveyi oxidoreductases with homologs in other bacteria?

Comparative analysis of V. harveyi oxidoreductases with homologs in other bacteria reveals important evolutionary insights:

  • Domain Conservation and Divergence: The presence of the FAD_binding_2 domain in both fumarate reductases and the acrylate reductase (ARD) suggests a common evolutionary origin, with subsequent specialization for different substrates .

  • Motif Variations and Substrate Specificity: The substitution of histidine with methionine in Motif II and changes in Motif III of ARD compared to fumarate reductases demonstrate how relatively few mutations in key catalytic motifs can dramatically alter substrate specificity .

  • Environmental Adaptation: The presence of acrylate reductase in marine bacteria like V. harveyi likely represents an adaptation to marine environments where acrylate is produced by algae and other organisms.

  • Horizontal Gene Transfer: Analysis of related oxidoreductases across bacterial species may reveal patterns of horizontal gene transfer, particularly for genes located on mobile genetic elements like plasmids. V. harveyi is known to contain multiple plasmids that may facilitate such transfer .

  • Evolution of Cofactor Binding: The complex cofactor arrangement in ARD, with one covalently bound FMN and non-covalently bound FAD and FMN in a 1:1:1 ratio , suggests evolution of sophisticated electron transfer mechanisms.

How might climate change impact the expression and function of Vibrio harveyi oxidoreductases?

Climate change may significantly impact the expression and function of V. harveyi oxidoreductases through several mechanisms:

  • Temperature Effects on Enzyme Activity: Research has shown that temperature influences phenotypic indicators of virulence in V. harveyi, with increased activity at 28°C and 34°C compared to 22°C . This suggests that rising ocean temperatures may alter the activity profiles of V. harveyi enzymes, including oxidoreductases.

  • Expression Regulation: The observed differences in ard gene expression under aerobic versus anaerobic conditions suggest that changes in ocean oxygenation (e.g., expanding oxygen minimum zones) could affect the expression patterns of these enzymes.

  • Substrate Availability: Climate-induced changes in marine microbial communities may alter the availability of substrates like acrylate, potentially affecting the selective pressures on enzymes like ARD.

  • Increased Virulence Potential: Temperature fluctuations associated with climate change may act as a stressor on bacteria, potentially increasing virulence gene expression and host adaptation . This could indirectly affect metabolic adaptations involving oxidoreductases.

  • Expansion of Vibrio Range: Warming oceans are expanding the geographical range of Vibrio species, potentially bringing these bacteria into new environments with different selective pressures.
    Understanding these climate-related impacts will be essential for predicting changes in marine bacterial metabolism and potential implications for aquaculture and marine ecosystems.

What is the optimal protocol for purifying recombinant Vibrio harveyi oxidoreductases?

Based on successful purification of V. harveyi ARD, the following optimized protocol is recommended for recombinant oxidoreductases:
Purification Protocol:

  • Expression System: Clone the gene into pBAD-TOPO vector with C-terminal 6His tag .

  • Cell Lysis: Resuspend cells in buffer containing 50 mM sodium phosphate (pH 8.0), 300 mM NaCl, and 5 mM imidazole. Lyse by sonication or pressure homogenization.

  • Initial Purification: Load clarified lysate onto Ni-NTA resin, wash with buffer containing 20 mM imidazole, and elute with buffer containing 250 mM imidazole .

  • Secondary Purification: Apply eluted protein to a gel filtration column (e.g., Superdex 200) equilibrated with 50 mM potassium phosphate buffer (pH 7.0) containing 100 mM NaCl.

  • Quality Control: Assess purity by SDS-PAGE (>95% purity) and confirm identity by Western blot and/or mass spectrometry.

  • Activity Verification: Measure enzymatic activity using appropriate substrates. For ARD, measure NADH oxidation in the presence of acrylate .

  • Storage: Store purified enzyme in 50 mM potassium phosphate buffer (pH 7.0) with 100 mM NaCl and 10% glycerol at -80°C. Avoid repeated freeze-thaw cycles.
    This protocol should be adaptable to other V. harveyi oxidoreductases with minor modifications based on specific protein properties.

What analytical techniques can identify post-translational modifications in Vibrio harveyi oxidoreductases?

Post-translational modifications in V. harveyi oxidoreductases, particularly flavin attachment, require specialized analytical techniques:

  • Fluorescence Detection: For covalently bound flavins, perform SDS-PAGE followed by UV illumination to detect fluorescent bands .

  • Peptide Mass Fingerprinting: Digest purified protein with trypsin and analyze by MALDI-TOF MS to identify peptides with mass shifts indicative of modifications.

  • Liquid Chromatography-Tandem Mass Spectrometry (LC-MS/MS): For precise identification of modification sites. This technique successfully identified Thr165 as the site of FMN attachment in ARD's FMN_bind domain .

  • Absorption Spectroscopy: Analyze spectral properties before and after denaturation to distinguish between covalently and non-covalently bound flavins.

  • Chemical Methods: Treat the protein with trichloroacetic acid to precipitate the protein while releasing non-covalently bound flavins, then quantify both the released and retained flavins to determine the extent of covalent binding.

  • Phosphoproteomic Analysis: For identifying phosphorylation sites, which may be relevant for proteins like ARD where FMN is attached via a phosphoester bond .
    These techniques collectively enable comprehensive characterization of post-translational modifications, which is essential for understanding the structure-function relationships of these enzymes.

How can researchers design targeted mutagenesis studies to understand substrate specificity in Vibrio harveyi oxidoreductases?

Targeted mutagenesis studies to understand substrate specificity in V. harveyi oxidoreductases should focus on key residues in the catalytic motifs:
Mutagenesis Strategy:

  • Target Residue Selection:

    • Motif I: Mutate the conserved arginine that interacts with the carboxyl group of substrates

    • Motif II: Create reciprocal mutations between ARD and fumarate reductase (e.g., Met→His in ARD and His→Met in fumarate reductase) to test substrate specificity switching

    • Motif III: Target the conserved arginine residue affiliated with both Motifs I and III

    • Conserved Threonine: Mutate Thr808 in ARD, which may contribute to residual activity against fumarate

  • Mutagenesis Methodology:

    • Use site-directed mutagenesis with the QuikChange method or PCR-based overlap extension

    • Generate single, double, and multiple mutations to assess additive or synergistic effects

    • Include control mutations outside the predicted active site

  • Functional Characterization:

    • Determine Km, kcat, and kcat/Km values for multiple substrates (acrylate, fumarate, methacrylate, etc.)

    • Construct substrate specificity profiles for each mutant

    • Measure thermal stability to ensure mutations don't disrupt protein folding

  • Structural Analysis:

    • Perform molecular modeling of mutants to predict structural changes

    • If possible, obtain crystal structures of key mutants to directly visualize changes in substrate binding This systematic approach will help elucidate the molecular determinants of substrate specificity in these enzymes and may enable the rational design of oxidoreductases with novel substrate preferences.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.