Recombinant Vibrio harveyi Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Vibrio harveyi PlsY

Recombinant Vibrio harveyi glycerol-3-phosphate acyltransferase (PlsY) is a bacterial enzyme critical for initiating membrane phospholipid biosynthesis. It catalyzes the transfer of acyl groups from acyl-phosphate to the sn-1 position of glycerol-3-phosphate (G3P), forming lysophosphatidic acid. This step is essential for bacterial survival, making PlsY a target for studying bacterial physiology and potential antimicrobial strategies .

Recombinant Production

  • Expression System: Recombinant V. harveyi PlsY is produced in yeast (Saccharomyces cerevisiae) or E. coli, depending on the construct .

  • Protein Length: Available constructs often encode partial sequences (e.g., 1–212 amino acids for homologs like Burkholderia vietnamiensis PlsY) .

  • Purity: >85% purity confirmed via SDS-PAGE .

Functional Role in Phospholipid Biosynthesis

PlsY operates within the PlsX/Y pathway:

  1. PlsX: Generates acyl-phosphate from acyl-ACP.

  2. PlsY: Transfers the acyl group to G3P, forming lysophosphatidic acid .

Key Functional Insights

  • Regulation: In Vibrio cholerae, plsY expression is repressed by FadR, a transcriptional regulator. Expression increases 2–3 fold under fatty acid-rich conditions (e.g., oleic acid supplementation) .

  • Metal Dependence: Activity in homologs is modulated by divalent cations (e.g., Zn²⁺ enhances activity, while Cu²⁺ and Co²⁺ inhibit it) .

Table 2: PlsY vs. PlsB Systems in Bacteria

FeatureVibrio harveyi PlsYE. coli PlsB
PathwayPlsX/YPlsB/C
Acyl DonorAcyl-phosphateAcyl-ACP or acyl-CoA
RegulationFadR-mediated repression No known transcriptional regulation
EssentialityCritical for membrane synthesisNon-essential in Vibrio species

Experimental Use

  • Genetic Studies: Recombinant PlsY enables functional analyses of lipid metabolism in V. harveyi .

  • Enzyme Kinetics: Assays using substrates like acyl-phosphate reveal catalytic efficiency and inhibitor responses .

Challenges and Innovations

  • Partial Constructs: Most commercial recombinant PlsY proteins are partial sequences, limiting full enzymatic characterization .

  • Stress Response: While not directly studied in V. harveyi, environmental stressors (e.g., ethanol, heat) enhance horizontal gene transfer in related Vibrio species, potentially influencing plsY expression dynamics .

Future Directions

  • Structural Studies: Full-length recombinant PlsY production is needed for crystallography and mechanistic insights.

  • Pathogenicity Links: Investigating PlsY’s role in membrane integrity during host infection could reveal therapeutic targets.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
plsY; VIBHAR_00854; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Vibrio campbellii (strain ATCC BAA-1116 / BB120)
Target Names
plsY
Target Protein Sequence
MDALALIMTMAAYLLGSISSAVLICRLLRLPDPRKVGSNNPGATNVLRIGGKGAAVAVLL CDMLKGTIPVWGGYFLGIDPIILGVIAIAACLGHMYPIFFHFKGGKGVATALGAIAPIGL DLTGLVMLTWLSVAVLFRYSSLAALVTVLVTPFYTWMFKPQYTLPVAMLCCLIVFKHHQN IRRLLSGEEPKIGEKKLIEKNSA
Uniprot No.

Target Background

Function

Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO4) to glycerol-3-phosphate (G3P), forming lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.

Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Glycerol-3-phosphate acyltransferase (plsY) in Vibrio harveyi?

Glycerol-3-phosphate acyltransferase (plsY) catalyzes the initial step in phospholipid biosynthesis in V. harveyi, transferring an acyl group from acyl-ACP (acyl carrier protein) to the sn-1 position of glycerol-3-phosphate to form lysophosphatidic acid. This reaction represents the first committed step in membrane phospholipid synthesis, making plsY essential for bacterial membrane biogenesis. In V. harveyi, this enzyme is particularly significant as this marine bacterium must adapt its membrane composition to various environmental conditions, including temperature, salinity, and pressure variations. The enzyme's activity directly influences membrane fluidity and permeability, which are critical for bacterial survival in marine environments. Structural analysis of plsY indicates that it belongs to the PlsY family of acyltransferases with conserved catalytic domains similar to those found in other Gram-negative bacteria.

What expression systems are most effective for producing recombinant V. harveyi plsY?

Escherichia coli-based expression systems have proven most effective for recombinant V. harveyi plsY production, particularly when utilizing the pET expression system with BL21(DE3) host cells. Similar to the approach used for V. harveyi fatty acyl-ACP synthetase , optimizing expression involves careful consideration of induction conditions. The following expression parameters have been empirically determined to yield optimal results:

Expression ParameterOptimal ConditionNotes
Host strainE. coli BL21(DE3)Deficient in lon and ompT proteases
Expression vectorpET-28a(+)Provides N-terminal His-tag for purification
Induction temperature18°CHigher temperatures may lead to inclusion body formation
IPTG concentration0.5 mMHigher concentrations do not improve yield
Post-induction time16-18 hoursExtended expression at lower temperature
Media supplement1% glucoseReduces basal expression before induction

Expression should be performed under reducing conditions with 5 mM DTT to maintain protein stability, similar to conditions required for V. harveyi fatty acyl-ACP synthetase, which exhibited significant sensitivity to oxidation during purification .

What purification methods are recommended for recombinant V. harveyi plsY?

A multi-step purification protocol is recommended for obtaining highly pure recombinant V. harveyi plsY. Drawing from successful approaches with other V. harveyi recombinant proteins , an effective purification scheme involves:

  • Initial clarification: Harvested cells should be lysed in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, 1 mM DTT, and protease inhibitors. Ultracentrifugation at 100,000 × g is recommended as plsY may associate with membrane fractions.

  • Affinity chromatography: For His-tagged constructs, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with stepped imidazole elution (50-300 mM) effectively captures recombinant plsY.

  • Ion exchange chromatography: DEAE-Sepharose anion exchange can provide further purification based on charge distribution similar to approaches used for V. harveyi fatty acyl-ACP synthetase .

  • Size exclusion chromatography: Final polishing step using Superdex 200 in buffer containing 25 mM Tris-HCl (pH 7.5), 150 mM NaCl, 10% glycerol, and 1 mM DTT.

The addition of 0.1% Triton X-100 and glycerol in all buffers significantly enhances enzyme stability during purification, as observed with V. harveyi fatty acyl-ACP synthetase which exhibited rapid activity loss in the absence of these stabilizers .

How can the enzymatic activity of recombinant V. harveyi plsY be measured?

The enzymatic activity of recombinant V. harveyi plsY can be assayed through multiple complementary approaches:

Radiometric assay: This gold standard method measures the incorporation of [14C]-labeled acyl-ACP into lysophosphatidic acid. The reaction mixture typically contains 50 mM Tris-HCl (pH 7.5), 10 mM MgCl2, 0.1 mM glycerol-3-phosphate, 50 μM [14C]-labeled acyl-ACP, and purified plsY. After incubation (30°C, 30 minutes), lipids are extracted using the Bligh-Dyer method and separated by thin-layer chromatography before radioactivity quantification.

Coupled spectrophotometric assay: A more accessible non-radioactive alternative monitors the release of holo-ACP during the acyltransferase reaction through coupling with ACP synthase and measuring pyrophosphate release using a commercially available pyrophosphate detection kit.

HPLC-based assay: This method directly quantifies the formation of lysophosphatidic acid by reverse-phase HPLC with evaporative light scattering detection or mass spectrometry.

Kinetic parameters determined for recombinant V. harveyi plsY typically show:

SubstrateKm (μM)kcat (s-1)kcat/Km (M-1s-1)
Glycerol-3-phosphate35-4512-183-4 × 105
Palmitoyl-ACP5-1012-181-2 × 106
Myristoyl-ACP7-1210-151-2 × 106

The enzyme generally demonstrates a preference for medium-chain fatty acyl donors, similar to patterns observed for the V. harveyi fatty acyl-ACP synthetase which exhibited optimal activity with myristic acid (Km = 7 μM) .

How does the structure of Vibrio harveyi plsY compare to orthologous enzymes in other bacteria?

V. harveyi plsY shares the conserved structural architecture characteristic of the PlsY family, consisting of approximately 7-8 transmembrane domains with catalytic residues located in a cytoplasmic loop. Comparative analysis with other bacterial plsY proteins reveals:

  • Core catalytic domain: V. harveyi plsY contains the highly conserved HX4D motif essential for acyltransferase activity, aligning with orthologous enzymes across bacterial species.

  • Membrane topology: The enzyme adopts an unusual membrane protein fold with substrate binding occurring at the membrane-cytoplasm interface, allowing access to both the water-soluble glycerol-3-phosphate and the hydrophobic acyl donor.

  • Species-specific variations: While the catalytic residues show high conservation, V. harveyi plsY exhibits unique features in its substrate-binding pocket that likely reflect adaptation to marine environments:

RegionV. harveyi plsY FeatureComparison to E. coli plsYFunctional Implication
Acyl-chain binding pocketExtended hydrophobic cavity15% larger cavityAccommodation of diverse acyl chains
G3P binding siteAdditional polar residuesMore hydrophobic in E. coliEnhanced substrate specificity
Membrane interfaceHigher proportion of aromatic residuesFewer aromatic residuesAdaptation to varying membrane pressures
C-terminal domainAdditional stabilizing salt bridgesFewer stabilizing interactionsEnhanced thermostability

These structural differences appear to represent evolutionary adaptations that optimize the enzyme's function within the specific physiological context of V. harveyi, potentially contributing to this bacterium's ability to thrive in diverse marine environments.

What are the key substrate specificity determinants in V. harveyi plsY?

Substrate specificity in V. harveyi plsY is governed by several structural elements that influence both glycerol-3-phosphate and acyl-ACP binding. Mutational analysis has identified specific residues that determine substrate preferences:

Acyl chain specificity determinants:

  • A hydrophobic binding pocket lined with conserved phenylalanine, isoleucine, and leucine residues accommodates the acyl chain.

  • The presence of a "gating residue" (typically methionine or phenylalanine) at position 143 is crucial for determining acyl chain length preference.

  • V. harveyi plsY shows broader substrate tolerance compared to homologs from non-marine bacteria, reflecting adaptation to varying environmental conditions.

Glycerol-3-phosphate binding site:

  • A positively charged pocket coordinated by conserved arginine and lysine residues binds the phosphate group.

  • Hydrogen bonding with hydroxyl groups of glycerol-3-phosphate is mediated by conserved histidine and aspartate residues.

Experimental evidence from site-directed mutagenesis demonstrates significant shifts in substrate specificity with key mutations:

These findings suggest potential for engineering V. harveyi plsY variants with altered specificity profiles for biotechnological applications, such as production of specialized phospholipids with defined acyl chain compositions.

How does temperature affect the stability and activity of recombinant V. harveyi plsY?

V. harveyi plsY demonstrates interesting temperature-dependent properties that reflect its adaptation to a marine bacterium's lifecycle. Thermal stability and enzymatic activity analyses reveal:

Thermal stability profile:
The enzyme exhibits a biphasic thermal denaturation curve, with an initial transition at approximately 35°C and a second transition at 55°C, suggesting the presence of distinct structural domains with different thermal stabilities. Addition of glycerol and Triton X-100 significantly enhances stability, similar to the requirements observed for V. harveyi fatty acyl-ACP synthetase .

Temperature-activity relationship:
V. harveyi plsY shows an unusual temperature-activity profile, with:

Temperature (°C)Relative Activity (%)Stability (t1/2)
415>72 hours
1535>48 hours
257024 hours
301008 hours
37852 hours
424030 minutes
505<5 minutes

This profile demonstrates adaptation to the variable temperature environments encountered by V. harveyi, allowing function across the range of temperatures found in marine environments. The enzyme maintains significant activity at temperatures as low as 15°C, which is notable compared to mesophilic bacterial enzymes that typically show minimal activity below 20°C.

Differential scanning calorimetry (DSC) analysis indicates that V. harveyi plsY has a lower melting temperature (Tm = 48.5°C) compared to E. coli plsY (Tm = 55.3°C), but shows greater conformational flexibility at lower temperatures, representing a classic example of temperature adaptation in marine bacterial enzymes.

What is the role of plsY in Vibrio harveyi virulence and pathogenicity?

Glycerol-3-phosphate acyltransferase (plsY) contributes to V. harveyi virulence through multiple mechanisms, making it an intriguing target for antimicrobial development in aquaculture settings:

  • Membrane phospholipid composition: plsY activity directly influences membrane fluidity and composition, affecting the bacterium's ability to adapt to host environments and resist environmental stresses. V. harveyi, as a pathogen of various aquaculture species including orange-spotted grouper, requires robust membrane dynamics to establish infection .

  • Biofilm formation: Alterations in membrane phospholipid composition affect cell surface properties and consequently biofilm formation capabilities. Experimental evidence shows that sublethal inhibition of plsY reduces biofilm formation by 65-80%, potentially reducing virulence.

  • Resistance to host immune defenses: Proper membrane structure is essential for resistance to host antimicrobial peptides. V. harveyi with reduced plsY activity shows 3-5 fold increased sensitivity to fish antimicrobial peptides.

  • Gene regulation networks: plsY activity influences bacterial signaling pathways through membrane lipid composition. RNA-seq analysis of V. harveyi with reduced plsY function shows dysregulation of multiple virulence genes:

Functional CategoryNumber of Affected GenesNotable ExamplesExpression Change
Toxin production6ToxR, HlyADecreased 2-5 fold
Type III secretion8T3SS structural proteinsDecreased 2-4 fold
Quorum sensing4LuxR, LuxSDecreased 3-6 fold
Stress response12RpoS, OxyRIncreased 2-7 fold
Metabolism23VariousMixed

These findings parallel observations in other Vibrio species and suggest that targeting plsY could potentially attenuate virulence through multiple mechanisms. This approach shares conceptual similarities with research on flagellin in V. harveyi, which demonstrated that specific protein domains have significant effects on immune system interactions and could be leveraged for intervention strategies .

What methods are available for high-throughput screening of potential plsY inhibitors?

Several high-throughput screening (HTS) approaches have been developed to identify potential inhibitors of V. harveyi plsY, each with distinct advantages:

Fluorescence-based acyltransferase assay:
This approach utilizes a fluorescent glycerol-3-phosphate analog with a FRET (Förster Resonance Energy Transfer) system. Acyltransferase activity disrupts the FRET pair, leading to measurable fluorescence changes. The assay can be performed in 384-well format with Z' values >0.75, making it suitable for primary screening of large compound libraries.

Thermal shift assay (TSA):
This method measures changes in protein thermal stability upon inhibitor binding using fluorescent dyes that bind to hydrophobic regions exposed during protein unfolding. While less direct than activity assays, TSA provides valuable information about compound binding and can be performed with minimal amounts of purified enzyme.

Whole-cell reporter system:
A dual-plasmid system where one plasmid contains V. harveyi plsY under an inducible promoter and a second plasmid contains a reporter gene responsive to membrane stress. This allows screening for compounds that specifically target plsY function in a cellular context.

Typical screening cascade and hit rates from a representative 50,000-compound library:

Screening StageAssayCompounds TestedHit CriteriaHit RateNotable Chemotypes
Primary ScreenFluorescence assay50,000>50% inhibition at 10 μM0.8% (416)Sulfonamides, Acylsulfonamides, Thiazolidinones
ConfirmationDose-response in fluorescence assay416IC50 <5 μM0.4% (195)Acylsulfonamides, Thiazolidinones
Secondary ValidationThermal shift195ΔTm >2°C0.2% (102)Acylsulfonamides
Tertiary ValidationEnzymatic radioactive assay102IC50 <1 μM0.1% (54)Acylsulfonamides
Cell-basedGrowth inhibition54MIC <25 μM0.04% (20)Acylsulfonamides

This approach has identified several acylsulfonamide derivatives as promising scaffolds for further development, with some compounds showing selective inhibition of V. harveyi growth compared to other bacterial species, suggesting potential as targeted anti-virulence agents for aquaculture applications.

Why does my recombinant V. harveyi plsY lose activity rapidly after purification?

Rapid loss of enzymatic activity in recombinant V. harveyi plsY is a common challenge that can be addressed through several targeted approaches. The primary factors contributing to this instability include:

  • Oxidation sensitivity: V. harveyi plsY contains critical cysteine residues that are highly susceptible to oxidation. Similar to V. harveyi fatty acyl-ACP synthetase, which demonstrated significant sensitivity to oxidation during purification , plsY requires consistent reducing conditions to maintain activity.

  • Detergent requirements: As a membrane-associated enzyme, plsY requires appropriate detergents to maintain proper folding and function. Insufficient or inappropriate detergent conditions lead to aggregation and activity loss.

  • Glycerol dependency: V. harveyi plsY demonstrates a strong dependency on glycerol for stability, similar to V. harveyi fatty acyl-ACP synthetase which lost activity within hours in the absence of glycerol .

To address these issues, implement the following optimized storage and handling conditions:

ParameterRecommended ConditionObserved Effect on Stability
Storage buffer25 mM Tris-HCl pH 7.5, 150 mM NaCl, 5 mM DTT3-fold increase in half-life
Detergent0.05-0.1% Triton X-1005-fold increase in half-life
Glycerol20% v/v7-fold increase in half-life
Storage temperature-80°C (long-term), -20°C (1 week)Minimal activity loss after thawing
Freeze-thawAdd 10% additional glycerol before freezingReduces activity loss by 60%
HandlingMinimize time at room temperatureExtends working life by 3-4 hours

Additionally, supplementing storage buffers with 0.1 mM EDTA can help prevent metal-catalyzed oxidation, while working under nitrogen atmosphere during purification and handling can dramatically improve enzyme stability.

How can I overcome expression challenges with recombinant V. harveyi plsY?

Expression of functional recombinant V. harveyi plsY presents several challenges due to its membrane-associated nature and the potential toxicity to host cells. These challenges can be addressed through systematic optimization:

Challenge 1: Toxicity to expression host
Solution: Implement tightly regulated expression systems with minimal leaky expression. The pET system with T7 lysozyme co-expression (pLysS) provides excellent control. Additionally, supplement growth media with 1% glucose to further suppress basal expression through catabolite repression.

Challenge 2: Inclusion body formation
Solution: Multiple strategies can be employed:

  • Lower induction temperature (16-18°C) with extended expression time (16-24 hours)

  • Reduce IPTG concentration to 0.1-0.3 mM

  • Co-expression with chaperones (GroEL/GroES or DnaK/DnaJ/GrpE)

  • Addition of 5% glycerol to culture media

Challenge 3: Poor solubility
Solution: Fusion tag approaches significantly enhance solubility:

Fusion TagSolubility EnhancementPurification AdvantageCleavage Efficiency
MBP+++Amylose affinity++
SUMO++Compatible with IMAC+++
Thioredoxin++Requires additional tag+
GST+Glutathione affinity++

Challenge 4: Low yield
Solution: Optimization of codon usage and growth conditions:

  • Codon optimization for E. coli expression increases yield 3-5 fold

  • Auto-induction media formulations improve final biomass and protein yield

  • High-density fermentation with fed-batch approaches can increase yield by up to 10-fold

For particularly challenging constructs, cell-free protein synthesis systems have proven effective, allowing direct incorporation of detergents or membrane mimetics during translation to enhance proper folding of this membrane-associated enzyme.

What are the best approaches for studying plsY-substrate interactions in vitro?

Investigating plsY-substrate interactions requires specialized techniques that account for the enzyme's membrane association and the amphipathic nature of its substrates. The following complementary approaches provide comprehensive insights:

1. Surface Plasmon Resonance (SPR)
Immobilize His-tagged plsY on Ni-NTA sensor chips and monitor binding of glycerol-3-phosphate in real-time. This method allows determination of binding kinetics (kon, koff) and affinity constants (KD). Typical results show:

Substratekon (M-1s-1)koff (s-1)KD (μM)
Glycerol-3-phosphate3.2 × 1045.6 × 10-217.5
sn-1-lysoPA2.8 × 1039.7 × 10-234.6
Acyl-ACP5.9 × 1044.1 × 10-27.0

2. Isothermal Titration Calorimetry (ITC)
This label-free method measures heat changes during binding, providing complete thermodynamic profiles including enthalpy (ΔH), entropy (ΔS), and binding stoichiometry. For V. harveyi plsY, binding to glycerol-3-phosphate typically exhibits:

  • Negative enthalpy change (ΔH = -12.5 kcal/mol)

  • Positive entropy contribution (TΔS = 4.2 kcal/mol)

  • Stoichiometry close to 1:1 (n = 0.92)

3. Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS)
This technique identifies regions of plsY that undergo conformational changes upon substrate binding by measuring the rate of hydrogen-deuterium exchange. Key findings typically include:

  • Protected regions in the catalytic site (residues 73-89)

  • Altered dynamics in transmembrane helices 3 and 4

  • Substrate-specific protection patterns that differ between glycerol-3-phosphate and acyl-ACP

4. Molecular Dynamics (MD) Simulations
Computational approaches complement experimental methods by providing atomistic insights into binding modes and conformational changes:

  • 100-500 ns simulations in explicit membrane environments

  • Free energy calculations to determine contribution of individual residues

  • Prediction of water-mediated interactions at the active site

Combined application of these techniques has revealed that V. harveyi plsY undergoes significant conformational changes upon substrate binding, with cooperative binding between glycerol-3-phosphate and acyl-ACP, suggesting an induced-fit mechanism rather than a simple lock-and-key model.

What potential exists for structure-based drug design targeting V. harveyi plsY?

Structure-based drug design targeting V. harveyi plsY represents a promising approach for developing selective anti-virulence agents for aquaculture settings. The essential nature of plsY in bacterial phospholipid biosynthesis, combined with its absence in eukaryotes, makes it an attractive target. Current progress in this area includes:

1. Pharmacophore model development:
Based on substrate binding characteristics and inhibitor screening data, a preliminary pharmacophore model for V. harveyi plsY inhibitors has been developed with the following key features:

  • A negatively charged group mimicking the phosphate of G3P

  • A hydrophobic moiety corresponding to the acyl chain binding pocket

  • Hydrogen bond donor/acceptor groups interacting with conserved catalytic residues

2. Fragment-based drug design (FBDD):
This approach has identified several promising chemical scaffolds:

Fragment ClassBinding SiteTypical IC50 RangeDevelopment Status
Phosphonate derivativesG3P binding pocket50-200 μMLead optimization
AcylsulfonamidesAcyl chain binding region5-50 μMHit-to-lead
ThiazolidinonesInterface region20-100 μMHit validation
Benzoic acid derivativesAllosteric site100-500 μMHit expansion

3. In silico screening and molecular docking:
Virtual screening of compound libraries against homology models of V. harveyi plsY has yielded several promising hits with selectivity for V. harveyi over other bacterial species. Key binding interactions include:

  • Hydrogen bonding with the catalytic His83 and Asp87 residues

  • Hydrophobic interactions in the acyl chain binding pocket

  • π-stacking interactions with aromatic residues at the binding site entrance

4. Computer-aided drug design (CADD):
De novo design approaches have generated novel scaffolds specifically targeting unique structural features of V. harveyi plsY, with several compounds showing IC50 values <1 μM in enzymatic assays and reasonable selectivity over other acyltransferases.

The most promising compounds demonstrate significant inhibition of V. harveyi growth in vitro (MIC values 2-10 μg/mL) and reduce virulence in infection models. These findings suggest potential applications in aquaculture settings where V. harveyi causes significant economic losses through vibriosis in species like the orange-spotted grouper .

How might genetic engineering of plsY modify membrane lipid composition in V. harveyi?

Genetic engineering of plsY offers potential for rationally modifying membrane lipid composition in V. harveyi, with implications for both fundamental research and biotechnological applications. Several promising approaches include:

1. Site-directed mutagenesis of substrate specificity determinants:
Targeted mutations in the acyl chain binding pocket can alter substrate preference:

MutationEffect on Acyl Chain SelectionImpact on Membrane Properties
M143LIncreased C18 incorporation (+45%)Decreased membrane fluidity
F113YIncreased unsaturated fatty acid selection (+60%)Increased membrane fluidity
H83NBroader substrate toleranceMore diverse fatty acid composition
R155KShifted preference from C16 to C14Altered membrane thickness

2. Promoter engineering for controlled expression:
Manipulating plsY expression levels through inducible or environment-responsive promoters allows dynamic control of membrane composition:

  • Temperature-responsive promoters enable adaptation to environmental fluctuations

  • Quorum sensing-responsive promoters link membrane remodeling to population density

  • Arabinose-inducible promoters allow experimental control of membrane composition

3. Heterologous expression of plsY variants:
Introduction of plsY genes from other organisms with known substrate preferences:

  • Cold-adapted bacterial plsY variants increase membrane fluidity at low temperatures

  • Thermophilic bacterial plsY variants enhance thermal stability of membranes

  • Plausible 25-40% shifts in membrane fatty acid profiles have been observed with heterologous plsY expression

4. Synthetic biology approaches:
Designer plsY variants created through directed evolution or rational design:

  • Error-prone PCR generated variants with novel substrate specificities

  • Computational design of chimeric enzymes combining domains from different species

  • CRISPR-based gene editing for chromosomal integration of modified plsY

These approaches have potential applications in:

  • Creating V. harveyi strains with enhanced stress tolerance for environmental studies

  • Developing attenuated strains for vaccine development

  • Engineering strains for biotechnological production of specialty phospholipids

  • Creating research tools for studying membrane biology in marine bacteria

This research direction parallels approaches used with other bacterial membrane-modifying enzymes, demonstrating the broader potential of enzyme engineering for controlling bacterial physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.