Recombinant Vibrio harveyi Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, if you require a specific format, please indicate your preference when placing the order. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by numerous factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; VIBHAR_00981; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Vibrio campbellii (strain ATCC BAA-1116 / BB120)
Target Names
lspA
Target Protein Sequence
MSEKALTLKQSGVRWLWLAILVFIADIGIKLVVMDNMGYGWANRIEVLPFFNLLYVHNYG AAFSFLSDQAGWQRWLFTGIAFVVTGLLTYWMSKLPAKEKWNNIAYALIIGGAVGNVFDR VVHGFVVDYLDFFWGSYHWPAFNLADTTICIGAAMIILDGFRKKDANK
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Vibrio harveyi lipoprotein signal peptidase (lspA) and what is its primary function?

Lipoprotein signal peptidase (lspA) in V. harveyi is a membrane-embedded enzyme responsible for the maturation of bacterial lipoproteins by cleaving signal peptides from prolipoproteins. This processing is essential for proper localization and function of lipoproteins, which play critical roles in bacterial cell envelope integrity, nutrient acquisition, and virulence mechanisms. As a Gram-negative pathogen that causes vibriosis in various aquaculture species including orange-spotted grouper (Epinephelus coioides), V. harveyi relies on properly processed lipoproteins for survival and pathogenicity .

What expression systems are most effective for recombinant V. harveyi lspA production?

Based on successful approaches with other V. harveyi proteins, Escherichia coli expression systems represent the primary platform for recombinant lspA production. The methodological approach typically involves:

  • Gene amplification from V. harveyi genomic DNA

  • Cloning into expression vectors containing inducible promoters (T7, tac)

  • Transformation into specialized E. coli strains optimized for membrane protein expression (C41/C43)

  • Expression optimization through controlled parameters:

ParameterOptimization RangeNotes
Temperature16-30°CLower temperatures often reduce inclusion body formation
Inducer concentration0.1-1.0 mM IPTGTitration required for optimal expression
Media compositionLB, TB, 2YTRich media supports membrane protein production
Induction timingOD600 0.4-0.8Mid-log phase typically optimal

E. coli-based systems have demonstrated success with other V. harveyi recombinant proteins including flagellin A (VhFliA), suggesting similar approaches would be applicable for lspA .

What purification strategies maintain the functional integrity of recombinant lspA?

Purification of membrane-embedded enzymes like lspA requires specialized approaches that preserve native conformation and activity:

  • Membrane isolation via differential centrifugation

  • Solubilization using mild detergents (DDM, LDAO, or FC-12)

  • Affinity chromatography using genetically incorporated tags (His6, Strep-tag)

  • Size exclusion chromatography for increased purity and detergent exchange

  • Activity validation at each purification stage

Critical considerations include:

ChallengeSolution Strategy
Detergent selectionScreen multiple detergents for optimal extraction without denaturation
Protein stabilityInclude glycerol (10-20%) and appropriate ions in buffers
Aggregation preventionMaintain protein below critical concentration, optimize pH and ionic strength
Activity preservationValidate enzymatic function using fluorogenic peptide substrates

The search results indicate researchers have successfully purified other membrane-associated proteins from V. harveyi, suggesting these approaches can be adapted specifically for lspA .

What methods are available for assessing recombinant lspA activity?

Several complementary approaches can be employed to evaluate recombinant lspA functionality:

  • In vitro enzymatic assays:

    • Fluorogenic peptide substrates containing the consensus lipobox sequence

    • FRET-based assays monitoring real-time cleavage kinetics

    • Mass spectrometry analysis of cleavage products to confirm site specificity

  • Functional complementation:

    • Genetic rescue experiments in lspA-deficient bacterial strains

    • Restoration of lipoprotein maturation and associated phenotypes

  • Structural integrity assessment:

    • Circular dichroism spectroscopy for secondary structure evaluation

    • Thermal shift assays to determine protein stability

    • Limited proteolysis to probe folding quality

Activity measurements should include appropriate controls and standardized conditions to enable comparison between different experimental conditions and protein variants.

How does environmental stress influence expression and function of recombinant V. harveyi proteins?

Environmental stressors significantly impact V. harveyi biology and potentially affect recombinant protein expression patterns. Research demonstrates that specific stress conditions alter membrane permeability and gene transfer capability in V. harveyi, which has implications for recombinant protein studies:

Environmental StressObserved EffectResearch Implication
High temperature (40°C)Enhanced conjugation efficiencyMay alter membrane protein insertion
Ethanol exposure (8%)Modified cell surface propertiesCould affect recombinant protein folding
SDS treatment (0.42 mM)Increased membrane permeabilityPotential impact on membrane protein topology
pH shifts (0.04 M NaOH, 0.012 M HCl)Altered cellular physiologyMay influence protein expression patterns

These findings suggest that controlled environmental stress could be strategically applied to modulate recombinant lspA expression and membrane integration. Researchers should systematically evaluate how these factors affect lspA yield, folding, and activity when designing expression protocols .

What domain architecture characterizes V. harveyi lspA and how can domain deletion studies inform function?

Domain mapping and deletion studies can provide critical insights into structure-function relationships of lspA, similar to approaches demonstrated with V. harveyi flagellin A (VhFliA). A systematic approach includes:

  • Computational prediction of functional domains based on sequence conservation

  • Generation of domain deletion constructs through site-directed mutagenesis

  • Expression and purification of wild-type and deletion variants

  • Comparative analysis of:

    • Enzymatic activity

    • Membrane integration

    • Substrate specificity

    • Protein stability

Research with V. harveyi flagellin demonstrated that deletion of specific domains (ΔMV-VhFliA and ΔD0MV-VhFliA) resulted in differential cytokine induction profiles in different host species, highlighting how domain architecture influences biological function . Similar approaches with lspA could identify catalytic domains, membrane-anchoring regions, and substrate recognition motifs.

What is the relationship between lspA functionality and V. harveyi pathogenesis in aquaculture settings?

The role of lspA in V. harveyi pathogenesis represents a critical research area with implications for aquaculture disease management. V. harveyi causes vibriosis in various commercially important species including orange-spotted grouper (Epinephelus coioides) and potentially other teleost species . The relationship between lspA and pathogenesis can be investigated through:

  • Genetic approaches:

    • Creation of lspA knockout or catalytically inactive mutants

    • Evaluation of virulence in infection models

    • Complementation studies to confirm phenotype specificity

  • Proteomic analysis:

    • Identification of lipoproteins dependent on lspA processing

    • Characterization of lipoprotein functions in virulence

    • Comparison of lipoprotein profiles between virulent and avirulent strains

  • Host-pathogen interaction studies:

    • Assessment of lspA-processed lipoproteins in host immune recognition

    • Evaluation of inflammatory responses similar to those observed with flagellin

    • Examination of cytokine induction patterns (IL-1β, IL-6, IL-8) in response to wild-type versus lspA-deficient strains

Research suggests that bacterial components like flagellin can induce inflammatory cytokine expression in fish hosts, and similar mechanisms may apply to lipoproteins processed by lspA .

How might lspA interact with quorum sensing pathways in V. harveyi?

V. harveyi utilizes sophisticated quorum sensing (QS) systems to regulate collective behaviors, with potential connections to lipoprotein processing pathways. Research has identified LuxT as a controller of specific QS-regulated behaviors in V. harveyi, working through a pathway involving small RNAs (Qrr1) . Potential interactions between lspA and QS could include:

  • Regulatory connections:

    • Investigation of lspA expression patterns in QS mutants

    • Analysis of LuxT binding to lspA promoter regions

    • Evaluation of small RNA-mediated post-transcriptional regulation

  • Functional relationships:

    • Assessment of QS-regulated phenotypes in lspA mutants

    • Characterization of lipoproteins involved in QS signal detection

    • Examination of membrane integrity effects on signal molecule diffusion

Experimental ApproachResearch QuestionMethodology
Transcriptional analysisIs lspA expression QS-regulated?qRT-PCR comparing lspA expression across growth phases and in QS mutants
Translational reporter assayDoes Qrr1 regulate lspA post-transcriptionally?Construction of translational fusions (lspA-mVenus) as described for other targets
Phenotypic analysisDoes lspA deficiency affect QS phenotypes?Evaluation of bioluminescence, biofilm formation, and virulence factor production

These investigations could reveal previously unrecognized connections between lipoprotein processing and bacterial communication systems .

What genetic manipulation strategies are most effective for studying V. harveyi lspA in vivo?

Recent advances have overcome traditional challenges in genetic manipulation of V. harveyi, offering improved methods for in vivo lspA studies. Research indicates that environmental stress treatments significantly enhance conjugation efficiency, facilitating genetic modification approaches:

Stress TreatmentConjugation EnhancementProtocol Details
Heat shock (40°C)Effective for 15-60 minutesPlate mating on LBS media with selection
Ethanol (8%)5-minute exposure optimalSuspension in 3% NaCl after mating
SDS (0.42 mM)5-minute treatmentRequires careful washing steps
NaOH (0.04-0.05 M)5-20 minute treatment yields up to 2,300 transconjugantsOptimal for homologous recombination
HCl (0.012-0.024 M)5-30 minute treatment yields up to 180 transconjugantsAlternative acid stress approach

These optimized protocols enable homologous recombination-based gene knockout techniques in V. harveyi, providing valuable tools for studying lspA function through genetic complementation, site-directed mutagenesis, and gene replacement strategies .

How can mutagenesis approaches identify critical residues in V. harveyi lspA?

Systematic mutagenesis studies can map the functional landscape of lspA by identifying catalytic residues, substrate binding determinants, and structural elements:

  • Target selection strategy:

    • Multiple sequence alignment with homologous signal peptidases

    • Structural homology modeling to predict functional sites

    • Conservation analysis across Vibrio species

  • Mutagenesis methodology:

    • Site-directed mutagenesis of conserved residues

    • Alanine-scanning of putative catalytic and binding sites

    • Construction of chimeric proteins with lspA from other species

  • Functional evaluation:

    • Quantitative enzyme kinetics comparing mutant and wild-type proteins

    • Substrate specificity profiling using peptide libraries

    • In vivo complementation efficiency in lspA-deficient backgrounds

Successful genetic manipulation methods developed for V. harveyi, including stress-enhanced conjugation techniques, provide practical approaches for introducing and evaluating lspA mutations in the native host background .

What are the comparative differences in lspA function between V. harveyi and other bacterial pathogens?

Comparative analysis of lspA across bacterial species can reveal adaptations specific to V. harveyi's ecological niche and pathogenic lifestyle. A systematic comparison would include:

  • Sequence and structural comparison:

    • Phylogenetic analysis of lspA across Vibrio and other genera

    • Identification of V. harveyi-specific sequence motifs

    • Structural modeling to predict functional differences

  • Substrate preference analysis:

    • Comparative processing of lipoprotein panels from different species

    • Identification of signal peptide features that determine specificity

    • Cross-species complementation experiments

  • Host-specific adaptations:

    • Analysis of lspA expression during infection of different hosts

    • Comparison of processed lipoprotein profiles across host environments

    • Evaluation of temperature and salt concentration effects on activity

This comparative approach could identify unique features of V. harveyi lspA that contribute to its success as an aquaculture pathogen affecting species like orange-spotted grouper and koi carp .

What emerging technologies are advancing the study of membrane proteins like lspA?

Recent technological innovations offer new approaches for studying challenging membrane proteins like lspA:

  • Structural biology advancements:

    • Cryo-electron microscopy for membrane protein structures without crystallization

    • Lipid nanodiscs for stabilizing membrane proteins in near-native environments

    • Hydrogen-deuterium exchange mass spectrometry for dynamics studies

  • Functional characterization tools:

    • Microfluidic enzyme assays for minimal sample consumption

    • Single-molecule fluorescence for real-time activity monitoring

    • Label-free biosensors for kinetic measurements

  • Genetic and cellular approaches:

    • CRISPR-Cas9 genome editing optimized for V. harveyi

    • Fluorescent D-amino acid incorporation for visualizing peptidoglycan processing

    • Super-resolution microscopy for subcellular localization

  • Computational methods:

    • Molecular dynamics simulations of membrane-embedded enzymes

    • Machine learning approaches for predicting substrate specificity

    • Systems biology models integrating lspA into cellular pathways

These emerging technologies can be applied to better understand the structure, function, and regulation of V. harveyi lspA in both basic research and applied contexts related to aquaculture pathogen management .

What expression optimization strategies address the challenges of membrane protein production?

Optimizing recombinant membrane protein expression requires systematic evaluation of multiple parameters:

ParameterOptimization ApproachEvaluation Metrics
Expression vectorCompare promoter strength (T7, tac, araBAD)Protein yield, solubility
Signal sequenceTest native vs. optimized leader peptidesMembrane targeting efficiency
Host strainE. coli C41/C43 vs. BL21 derivativesToxicity tolerance, folding quality
Expression temperatureGradient from 15-37°CInclusion body formation, activity
Membrane extractionDetergent panel screeningExtraction efficiency, activity retention

A critical consideration is the temperature-dependent expression profile. Research with other V. harveyi proteins suggests that lower temperatures (20-25°C) often yield properly folded membrane proteins, while preventing stress responses that can interfere with recombinant protein production .

How should researchers design controls for lspA activity assays?

Robust experimental design for lspA activity assays requires appropriate controls to distinguish specific enzymatic activity from background effects:

  • Negative controls:

    • Heat-inactivated enzyme preparations

    • Catalytically inactive mutants (substitutions at predicted active site)

    • Assay buffer without enzyme

  • Positive controls:

    • Commercial signal peptidases with known activity

    • Well-characterized bacterial lspA homologs

    • Synthetic peptide standards with verified cleavage products

  • Specificity controls:

    • Non-lipoprotein signal peptides to confirm lipobox specificity

    • Peptide substrates with mutated lipobox motifs

    • Competitive inhibitors to validate active site engagement

  • Validation approaches:

    • Orthogonal detection methods (fluorescence, HPLC, mass spectrometry)

    • Concentration-dependent activity profiles

    • Time-course analysis to establish linear reaction ranges

These controls enable confident interpretation of experimental results and facilitate comparison between different experimental conditions or protein variants.

What strategies address common challenges in recombinant lspA production?

Researchers frequently encounter specific challenges when working with membrane proteins like lspA:

ChallengePotential CausesTroubleshooting Approach
Low expression yieldToxicity, codon bias, promoter leakageTight expression control, codon optimization, induction timing
Inclusion body formationRapid expression, improper foldingLower temperature, co-expression with chaperones, fusion tags
Loss of activity during purificationDetergent effects, cofactor lossScreen detergent panel, supplement cofactors, optimize pH
Inconsistent activity measurementsSubstrate variability, buffer effectsStandardize substrate preparation, control temperature and pH
Poor membrane extractionDetergent incompatibilityTest multiple detergent classes, optimize detergent:protein ratio

The environmental stress conditions shown to affect V. harveyi membrane properties might also influence recombinant protein behavior, suggesting potential for strategic application of controlled stress during expression or purification protocols .

How can researchers overcome the limited information available specifically on V. harveyi lspA?

When working with proteins that have limited available literature, researchers can employ several strategies to build foundational knowledge:

  • Homology-based approaches:

    • Leverage information from well-characterized lspA homologs

    • Apply findings from other Vibrio species as starting points

    • Use comparative genomics to identify conserved features

  • Systematic characterization:

    • Start with basic biochemical parameters (pH optimum, temperature stability)

    • Develop preliminary activity assays based on consensus substrates

    • Generate baseline expression and purification protocols

  • Collaborative strategies:

    • Engage researchers working with other V. harveyi proteins

    • Partner with aquaculture pathogen specialists

    • Consult membrane protein experts for methodology adaptation

  • Iterative optimization:

    • Begin with protocols successful for other V. harveyi proteins

    • Implement small-scale expression screening before scaling up

    • Document conditions systematically to build institutional knowledge

This methodical approach builds a foundation of knowledge that can be refined through continued research and validation.

What statistical approaches are appropriate for analyzing lspA enzyme kinetics?

Proper statistical analysis ensures reliable interpretation of enzymatic data:

  • Kinetic parameter determination:

    • Non-linear regression for Michaelis-Menten kinetics

    • Lineweaver-Burk or Eadie-Hofstee transformations for visualization

    • Global fitting approaches for complex kinetic models

  • Comparative analysis:

    • ANOVA with post-hoc tests for multiple condition comparison

    • t-tests for pairwise comparisons with Welch's correction for unequal variances

    • Two-way ANOVA for factorial experimental designs

  • Quality control metrics:

    • R² values to assess goodness of fit

    • Residual analysis to detect systematic deviations

    • Confidence intervals for parameter estimates

  • Reporting standards:

    • Include both biological and technical replicates (n≥3)

    • Report standard deviations or standard errors consistently

    • Specify statistical tests and significance thresholds

Statistical approaches demonstrated in research with other V. harveyi proteins include two-way ANOVA followed by Tukey's multiple comparisons test and unpaired two-tailed t-tests with Welch's correction, which are appropriate for enzymatic data analysis .

How should researchers interpret species-specific differences when studying lspA function?

When analyzing lspA function across different host or bacterial species, careful interpretation is essential:

  • Species adaptation context:

    • Consider evolutionary pressures in different ecological niches

    • Evaluate host-specific immune recognition mechanisms

    • Examine temperature and salinity adaptations relevant to host environments

  • Functional conservation analysis:

    • Distinguish between core catalytic functions and species-specific adaptations

    • Evaluate substrate specificity in context of species-specific lipoproteins

    • Consider regulatory differences between species

  • Host response interpretation:

    • Account for differences in host immune systems when analyzing inflammatory responses

    • Consider species-specific patterns of cytokine expression

    • Evaluate pathology in context of natural host-pathogen relationships

Research with V. harveyi flagellin demonstrates how specific protein domains can elicit different inflammatory responses in different fish species (grouper versus carp), highlighting the importance of species-specific analysis .

What emerging areas present opportunities for advancing V. harveyi lspA research?

Several promising research frontiers could significantly advance understanding of V. harveyi lspA:

  • Systems biology integration:

    • Mapping lspA within broader virulence networks

    • Connecting lipoprotein processing to quorum sensing pathways

    • Developing predictive models of lspA contribution to pathogenesis

  • Host-pathogen interface:

    • Characterizing processed lipoproteins that interact with host immunity

    • Investigating species-specific recognition of V. harveyi lipoproteins

    • Developing vaccines targeting lspA-processed antigens

  • Structural biology:

    • Determining high-resolution structures of V. harveyi lspA

    • Mapping substrate binding pockets through co-crystallization

    • Visualizing conformational changes during catalysis

  • Therapeutic applications:

    • Developing specific inhibitors of V. harveyi lspA

    • Exploring lspA-processed lipoproteins as vaccine candidates

    • Engineering attenuated strains through lspA modification

These research directions build upon established knowledge of V. harveyi biology while addressing significant gaps in understanding of lipoprotein processing in this important aquaculture pathogen .

How might lspA research contribute to aquaculture disease management strategies?

Research on V. harveyi lspA has potential applications in addressing vibriosis in aquaculture settings:

  • Diagnostic development:

    • Identification of lspA-processed biomarkers specific to virulent strains

    • Development of molecular diagnostics targeting lspA variants

    • Creation of antibody-based detection systems for processed lipoproteins

  • Preventative approaches:

    • Design of subunit vaccines based on lspA-processed immunogens

    • Development of probiotics that competitively inhibit V. harveyi colonization

    • Engineering of lspA-targeting antimicrobial peptides

  • Treatment strategies:

    • Identification of lspA inhibitors as potential therapeutics

    • Development of combination approaches targeting multiple virulence pathways

    • Creation of phage therapy targeting lspA-dependent surface structures

  • Environmental management:

    • Understanding how environmental stressors affect lspA function and V. harveyi virulence

    • Developing husbandry practices that minimize conditions favoring pathogenesis

    • Creating early warning systems based on environmental triggers of virulence

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.