Recombinant Vibrio harveyi Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
nqrE; VIBHAR_03271; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Vibrio campbellii (strain ATCC BAA-1116 / BB120)
Target Names
nqrE
Target Protein Sequence
MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGVAVVVVLTIAVPVNNLVY NLVLKENALVEGVDLSFLNFITFIGVIAALVQILEMVLDRFFPPLYNALGIFLPLITVNC AIFGGVSFMVQRDYNFAESIVYGFGSGVGWMLAIVALAGIREKMKYSDVPPGLRGLGITF ITVGLMALGFMSFSGVQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two successive reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Na (+)-translocating NADH-quinone reductase complex and what role does subunit E play?

The Na (+)-translocating NADH-quinone reductase (Na+-NQR) is a respiratory complex found in Vibrio harveyi that couples the oxidation of NADH to the translocation of sodium ions across the bacterial membrane. Subunit E (nqrE) is one of six essential components (A-F) of this complex, serving as an integral membrane protein that participates in the sodium translocation channel structure . The Na+-NQR complex functions as an energy-conserving enzyme that contributes to the establishment of electrochemical gradients used for ATP synthesis and other cellular processes. Within this system, nqrE is crucial for maintaining the structural integrity of the complex and facilitating proper ion transport across the membrane .

How does nqrE contribute to Vibrio harveyi energy metabolism?

The nqrE subunit functions as part of the Na+-NQR complex, which serves as the primary NADH dehydrogenase in the respiratory chain of Vibrio harveyi. This complex catalyzes the oxidation of NADH while simultaneously pumping Na+ ions across the cytoplasmic membrane, generating an electrochemical gradient that drives ATP synthesis through ATP synthase. Unlike conventional NADH dehydrogenases that translocate protons, the Na+-NQR complex specifically translocates sodium ions, representing a specialized adaptation in marine bacteria like V. harveyi that live in sodium-rich environments . The nqrE subunit contains transmembrane domains that form part of the ion translocation pathway, making it essential for the energy conservation process in this bacterium.

What is the genetic organization of nqrE in Vibrio harveyi?

The nqrE gene is part of the nqr operon in Vibrio harveyi, identified in genomic studies as VIBHAR_03271 . It exists within a cluster of genes encoding the six subunits (nqrA-F) of the Na+-NQR complex. This organization reflects the functional relationship between these components and their coordinated expression. The gene encoding nqrE is conserved across Vibrio species, suggesting its evolutionary importance in the genus. Molecular analysis indicates that nqrE is expressed as part of a polycistronic mRNA, ensuring stoichiometric production of all Na+-NQR complex components. The genomic context of nqrE provides insights into the regulatory mechanisms controlling the expression of the entire Na+-NQR system in response to environmental conditions.

What are the optimal protocols for recombinant expression of Vibrio harveyi nqrE?

For recombinant expression of Vibrio harveyi nqrE, researchers typically employ prokaryotic expression systems, with E. coli being the preferred host organism due to its high efficiency and ease of genetic manipulation . The following protocol outline has proven effective:

  • Gene Preparation:

    • PCR amplification of the nqrE gene from Vibrio harveyi genomic DNA

    • Restriction enzyme digestion and ligation into an appropriate expression vector (pET or pBAD series)

    • Introduction of a purification tag (His6 or GST) at either the N- or C-terminus

  • Expression Conditions:

    • Transformation into E. coli expression strains (BL21(DE3) or C41(DE3) for membrane proteins)

    • Culture growth at 30°C to OD600 of 0.6-0.8

    • Induction with IPTG (0.1-0.5 mM) or arabinose (0.002-0.2%)

    • Post-induction growth at 18-25°C for 4-16 hours to minimize inclusion body formation

  • Membrane Protein Considerations:

    • Addition of 1% glycerol to growth media to stabilize membrane proteins

    • Inclusion of chaperone co-expression systems to improve folding

    • Use of specialized E. coli strains designed for membrane protein expression

Successful expression is typically confirmed via Western blotting using antibodies against the purification tag or the protein itself .

What purification strategies are most effective for isolating recombinant nqrE?

Due to nqrE being an integral membrane protein, specialized purification strategies are required:

  • Membrane Extraction:

    • Cell lysis via French press or sonication in buffer containing protease inhibitors

    • Low-speed centrifugation to remove cell debris (10,000 × g, 20 min)

    • Ultracentrifugation to collect membrane fraction (150,000 × g, 1 hour)

    • Membrane solubilization using detergents such as n-dodecyl-β-D-maltoside (DDM, 1-2%), LDAO, or Triton X-100

  • Affinity Chromatography:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged nqrE

    • Glutathione affinity chromatography for GST-tagged constructs

    • Inclusion of 0.02-0.05% detergent in all buffers to maintain protein solubility

  • Additional Purification:

    • Size exclusion chromatography to separate monomeric nqrE from aggregates

    • Ion exchange chromatography for further purification if needed

  • Quality Control:

    • SDS-PAGE and Western blotting to confirm purity and identity

    • Mass spectrometry for protein verification

    • Circular dichroism to assess proper folding

For functional studies, the purified protein should be maintained at >90% purity and stored in buffer containing glycerol at -20°C or -80°C to maintain stability .

How can researchers assess the functional activity of purified nqrE?

Assessing the functional activity of purified nqrE involves several complementary approaches:

  • Reconstitution Studies:

    • Incorporation into proteoliposomes or nanodiscs to mimic native membrane environment

    • Co-reconstitution with other Na+-NQR subunits to assess complex assembly

    • Measurement of sodium ion translocation using fluorescent indicators (e.g., SBFI)

  • Binding Assays:

    • Isothermal titration calorimetry to measure interactions with other NQR subunits

    • Surface plasmon resonance to quantify binding kinetics with protein partners

    • Pull-down assays to confirm interaction with other complex components

  • Structural Integrity Assessment:

    • Circular dichroism spectroscopy to verify secondary structure

    • Fluorescence spectroscopy to monitor tertiary structure

    • Limited proteolysis to probe folding quality

  • Functional Complementation:

    • Introduction of purified nqrE into nqrE-deficient membrane preparations

    • Assessment of NADH:quinone oxidoreductase activity restoration

    • Measurement of Na+ translocation in the reconstituted system

Activity measurements should include appropriate controls, such as heat-inactivated protein and known inhibitors of the Na+-NQR complex, to validate the specificity of observed activities.

What techniques can be used to study the interaction of nqrE with other subunits of the Na+-NQR complex?

Understanding the interactions between nqrE and other Na+-NQR subunits requires sophisticated biochemical and biophysical approaches:

These techniques provide complementary information that, when integrated, can generate a comprehensive model of nqrE interactions within the Na+-NQR complex.

How can quasi-experimental designs be applied to study nqrE function in environmental Vibrio harveyi populations?

Quasi-experimental designs offer valuable approaches for studying nqrE function in natural settings where randomized controlled trials may be impractical. Based on the quasi-experimental design principles outlined in source , the following methodological framework can be applied:

Validity ThreatMitigation Strategy
Selection biasCareful matching of control populations based on habitat parameters
History effectsMonitoring of external environmental variables during study period
MaturationInclusion of non-Vibrio bacterial controls to account for natural changes
Testing effectsUse of non-disruptive sampling techniques to minimize population disturbance
InstrumentationStandardization of molecular and biochemical assays across all sampling points

These quasi-experimental approaches enable researchers to study nqrE function in natural contexts while maintaining methodological rigor .

How does nqrE compare with analogous proteins in other bacterial species?

The Na+-translocating NADH-quinone reductase subunit E (nqrE) demonstrates interesting evolutionary and functional relationships when compared to similar proteins across bacterial taxa:

  • Evolutionary Conservation:

    • nqrE is highly conserved within the Vibrio genus, showing >85% sequence identity among Vibrio species

    • Moderate homology (40-60% identity) exists with nqrE proteins from other marine bacteria including Photobacterium and Shewanella species

    • More distant homologs (25-35% identity) are found in diverse bacteria including Haemophilus, Yersinia, and Pseudomonas

  • Functional Domains Comparison:

Domain FeatureVibrio harveyi nqrEOther Vibrio SpeciesNon-Vibrio Homologs
Transmembrane helices6 predicted TM domains6 TM domains (conserved)5-7 TM domains (variable)
Na+ binding motifsHighly conserved>90% identitySignificant variations
Quinone interaction sitesConservedHighly conservedOften absent or modified
Subunit interaction interfacesSpecific recognition sitesNearly identicalSubstantially divergent
  • Evolutionary Significance:

    • nqrE appears to have evolved specifically for sodium-rich marine environments

    • The protein shows evidence of co-evolution with other Na+-NQR subunits

    • Sequence conservation patterns suggest stronger selective pressure on transmembrane regions than loop domains

  • Functional Analogs vs. Homologs:

    • nqrE has no direct functional analog in the proton-pumping NADH dehydrogenases (Complex I) of mitochondria

    • Some functional convergence exists with certain subunits of other ion-translocating respiratory complexes

    • The unique sodium specificity of nqrE represents a specialized adaptation not found in most bacterial respiratory systems

This comparative analysis provides insights into the specialized role of nqrE in Vibrio harveyi's adaptation to marine environments and its potential as a target for species-specific interventions.

What genomic and proteomic approaches are most effective for studying nqrE in the context of Vibrio harveyi pathogenicity?

Integrated genomic and proteomic approaches offer powerful tools for elucidating the role of nqrE in Vibrio harveyi pathogenicity:

  • Genomic Approaches:

    • Whole Genome Sequencing: Comparative analysis of nqrE sequences from pathogenic and non-pathogenic V. harveyi strains to identify polymorphisms associated with virulence

    • Transcriptomics: RNA-Seq analysis to measure nqrE expression levels during different stages of infection and under various environmental conditions

    • Targeted Mutagenesis: CRISPR-Cas9 or homologous recombination-based gene editing to create nqrE variants for functional studies

    • PCR-Based Detection: Development of nqrE-specific primers for rapid identification of V. harveyi, similar to the toxR-based approaches described for species identification

  • Proteomic Approaches:

    • Differential Proteomics: Comparison of protein expression profiles between wild-type and nqrE-mutant strains to identify affected pathways

    • Protein-Protein Interaction Studies: Affinity purification coupled with mass spectrometry to identify nqrE interaction partners

    • Post-Translational Modification Analysis: Characterization of PTMs on nqrE that might regulate its function during pathogenesis

    • Activity-Based Protein Profiling: Use of activity probes to assess functional status of Na+-NQR complex during infection

  • Integrated Multi-Omics Framework:

ApproachPrimary Question AddressedMethodology
GenomicsWhat genetic variations in nqrE correlate with virulence?Comparative genomics of clinical isolates
TranscriptomicsWhen and how is nqrE expression regulated during infection?RNA-Seq of in vivo infection models
ProteomicsWhat proteins interact with nqrE during pathogenesis?Co-immunoprecipitation and MS analysis
MetabolomicsHow does nqrE function affect metabolic patterns in virulent strains?Targeted and untargeted metabolite profiling
PhenomicsWhat phenotypic traits correlate with nqrE variants?High-throughput phenotypic screening
  • Validation Approaches:

    • In vivo infection models using shrimp or other susceptible hosts

    • Ex vivo tissue culture systems to study host-pathogen interactions

    • Biochemical validation of identified molecular interactions

These approaches would build upon the molecular characterization methods used for V. harveyi identification , extending them to specifically understand nqrE's role in pathogenicity.

How can researchers distinguish between different functional states of nqrE using spectroscopic methods?

Spectroscopic techniques provide powerful tools for investigating the functional states of membrane proteins like nqrE. For researchers studying the conformational changes and functional states of nqrE, the following spectroscopic approaches are particularly valuable:

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Site-directed spin labeling of strategic residues in nqrE

    • Continuous wave EPR to monitor local environment changes during Na+ binding

    • Pulsed EPR techniques (DEER/PELDOR) to measure distances between labeled sites

    • Identification of conformational changes associated with different functional states

  • Fluorescence Spectroscopy:

    • Incorporation of environmentally sensitive fluorophores at key positions

    • Steady-state and time-resolved fluorescence to monitor conformational changes

    • Fluorescence quenching studies to probe accessibility of specific regions

    • FRET measurements between labeled domains to track relative movements

  • Vibrational Spectroscopy:

    • Fourier-transform infrared (FTIR) spectroscopy to monitor secondary structure changes

    • Resonance Raman spectroscopy to probe specific chemical bonds and their environments

    • Difference spectroscopy between active and inactive states to identify key vibrational signatures

    • Time-resolved approaches to capture transient intermediates during function

  • Functional State Identification Matrix:

Functional StateEPR SignatureFluorescence ProfileVibrational Spectroscopy Markers
Resting stateCharacteristic distance distribution between spin labelsBaseline fluorescence intensity and lifetimeStandard amide I/II band pattern
Na+-bound stateAltered spin-spin distances reflecting conformational changeFluorescence intensity changes in Na+-sensing regionsShifts in carboxylate vibrations
Quinone-interacting stateModified accessibility parametersQuenching of specific fluorophoresNew vibrations from quinone binding
Inhibitor-bound stateRestricted conformational freedomBlocked dynamic fluorescence changesAltered secondary structure signatures
  • Advanced Approaches:

    • Solid-state NMR of reconstituted nqrE in nanodiscs or liposomes

    • Mass spectrometry coupled with hydrogen-deuterium exchange (HDX-MS)

    • Single-molecule FRET to capture heterogeneity in conformational states

    • Time-resolved X-ray/neutron scattering for dynamic structural information

These spectroscopic methods, when used in combination, provide a comprehensive picture of nqrE conformational dynamics and functional states that cannot be captured by static structural methods alone.

What are the key challenges in expressing and purifying functional nqrE for structural studies?

Researchers face several critical challenges when attempting to express and purify nqrE for structural studies:

  • Membrane Protein Expression Barriers:

    • Toxicity to expression hosts due to membrane disruption

    • Inefficient membrane insertion leading to inclusion body formation

    • Proper folding dependent on lipid environment not replicated in heterologous systems

    • Challenges in scaling up production for structural studies

  • Purification Obstacles:

    • Detergent selection critical for maintaining native conformation

    • Protein instability outside the membrane environment

    • Loss of functional interactions with other Na+-NQR subunits

    • Aggregation during concentration steps required for structural studies

  • Functional Validation Complications:

    • Difficulty in assessing proper folding and activity in detergent-solubilized state

    • Reconstitution into artificial membranes often yields low efficiency

    • Functional assays complicated by requirement for other subunits

  • Strategic Approaches to Address Challenges:

ChallengeConventional ApproachAdvanced Strategy
Low expressionCodon optimizationCell-free expression systems
Inclusion body formationReduced induction temperatureFusion with solubility-enhancing partners
Detergent instabilityScreening multiple detergentsNanodiscs or SMALPs for detergent-free extraction
Functional assessmentIndirect activity assaysSingle-molecule techniques
Structure determinationX-ray crystallography attemptsCryo-EM of full complex or focused classification
  • Novel Technological Solutions:

    • Application of directed evolution to engineer more stable nqrE variants

    • Use of styrene-maleic acid lipid particles (SMALPs) for native membrane extraction

    • Implementation of fragment-based approaches focusing on critical domains

    • Development of conformation-specific nanobodies as crystallization chaperones

Researchers should consider these challenges when designing expression systems for nqrE and may need to implement multiple complementary approaches to achieve success in structural studies .

How can molecular dynamics simulations contribute to understanding nqrE function within the Na+-NQR complex?

Molecular dynamics (MD) simulations offer powerful in silico approaches to study the complex dynamics of membrane proteins like nqrE:

  • Simulation Setup and Parameters:

    • Construction of nqrE models based on homology modeling or experimental structures

    • Embedding in realistic membrane bilayers containing appropriate phospholipid compositions

    • Inclusion of explicit water molecules and ions at physiological concentrations

    • Application of validated force fields optimized for membrane protein simulations

    • Implementation of long timescale simulations (microseconds) to capture relevant dynamics

  • Key Research Questions Addressable through MD:

    • Identification of Na+ binding sites and ion coordination mechanisms

    • Elucidation of conformational changes accompanying ion translocation

    • Characterization of water accessibility and potential transport pathways

    • Analysis of protein-lipid interactions that influence nqrE function

    • Investigation of interaction dynamics with other Na+-NQR subunits

  • Advanced Simulation Approaches:

Simulation TechniqueResearch ApplicationComputational Requirements
Equilibrium MDBaseline dynamics and conformational samplingHigh-performance computing clusters
Steered MDInvestigation of ion translocation pathwaysMedium computational resources with specialized protocols
Free energy calculationsQuantification of ion binding energeticsExtensive sampling requiring supercomputing facilities
Coarse-grained simulationsLarger-scale dynamics of whole Na+-NQR complexModerate resources but requires specialized parameters
Multiscale modelingConnecting atomic details to functional mechanismsIntegration of multiple computational resources
  • Integration with Experimental Data:

    • Validation of simulation results against spectroscopic measurements

    • Refinement of models based on cross-linking constraints

    • Design of site-directed mutagenesis experiments based on simulation predictions

    • Interpretation of functional assays through structural dynamics lens

  • Technical Considerations:

    • Selection of appropriate protonation states for titratable residues

    • Careful equilibration protocols to ensure membrane stability

    • Implementation of constant-pH simulations where relevant

    • Analysis of convergence to ensure statistical significance of results

Through these approaches, MD simulations can provide atomic-level insights into nqrE function that complement experimental studies and generate testable hypotheses for further investigation.

What role could nqrE play in developing targeted antimicrobials against Vibrio harveyi in aquaculture settings?

The Na+-translocating NADH-quinone reductase subunit E (nqrE) represents a promising target for developing novel antimicrobials against Vibrio harveyi in aquaculture:

  • Target Validation Considerations:

    • Essential role of Na+-NQR in Vibrio harveyi energy metabolism

    • Structural differences between bacterial Na+-NQR and host respiratory complexes

    • Specificity potential due to unique sequence features in Vibrio harveyi nqrE

    • Precedent of respiratory chain components as successful antimicrobial targets

  • Drug Discovery Approaches:

    • High-throughput screening of compound libraries against purified nqrE

    • Structure-based design targeting critical functional domains

    • Fragment-based approaches to identify initial binding molecules

    • Repurposing of known Na+-NQR inhibitors with optimization for specificity

    • Peptide-based inhibitors designed to disrupt complex assembly

  • Potential Intervention Strategies:

ApproachMechanismDevelopment ComplexityPotential Advantages
Small molecule inhibitorsDirect binding to functional sitesModerateEstablished delivery methods, scalability
Peptide-based disruptorsInterference with subunit assemblyHighPotentially higher specificity
CRISPR-Cas deliveryTargeted gene disruptionVery highHighly specific, potentially self-propagating
Immunization approachAntibody-mediated complex disruptionHighHost-based protection mechanism
Phage therapyEngineered phages targeting nqrE-expressing bacteriaHighSpecificity and self-replication
  • Translation to Aquaculture Applications:

    • Development of water-soluble formulations for pond treatment

    • Feed incorporation strategies for oral delivery

    • Stability optimization for marine environment conditions

    • Regulatory considerations for aquaculture antimicrobials

    • Assessment of resistance development potential

  • Integration with Current Disease Management:

    • Complementary use with existing treatments for multi-target approach

    • Potential for reduced use of broad-spectrum antibiotics

    • Application in preventative measures during high-risk periods

    • Implementation in integrated disease management protocols

This approach builds upon the understanding of Vibrio harveyi pathogenicity mechanisms while targeting a specific component that is essential for bacterial energy metabolism but distinct from host systems.

What are the most significant recent advances in understanding nqrE function and structure?

Recent scientific advances have substantially enhanced our understanding of nqrE function and structure, though considerable research gaps remain. The most significant developments include:

  • Structural Insights:

    • Progress in membrane protein structural biology has enabled improved homology modeling of nqrE

    • Development of lipid nanodisc technologies has facilitated more native-like environments for structural studies

    • Advanced cryo-EM techniques have begun to resolve the structure of complete Na+-NQR complexes, including nqrE positioning

    • Identification of critical functional domains through targeted mutagenesis and functional studies

  • Mechanistic Understanding:

    • Elucidation of ion coordination mechanisms through combined computational and experimental approaches

    • Improved understanding of the electron transfer pathway within the Na+-NQR complex

    • Characterization of conformational changes associated with sodium translocation

    • Identification of specific residues essential for interaction with other subunits

  • Functional Context:

    • Recognition of Na+-NQR's role in Vibrio adaptation to specific environmental niches

    • Connection between nqrE function and expression of virulence-associated genes

    • Understanding of regulatory mechanisms controlling nqrE expression

    • Documentation of natural variants and their functional implications

  • Technological Advances Enabling Research:

    • Development of advanced genetic tools for Vibrio species

    • Improvement in recombinant membrane protein expression systems

    • Application of high-sensitivity spectroscopic methods for functional studies

    • Implementation of computational approaches for studying dynamic processes

Despite these advances, significant questions remain regarding the precise atomic-level mechanism of sodium translocation, the complete interaction network within the Na+-NQR complex, and the potential for targeting nqrE in antimicrobial development.

What methodological gaps need to be addressed to advance research on Vibrio harveyi nqrE?

Current research on Vibrio harveyi nqrE faces several methodological limitations that must be addressed to advance the field:

  • Genetic Manipulation Challenges:

    • Limited genetic tools optimized for Vibrio harveyi compared to model organisms

    • Difficulties in creating stable deletion mutants of essential genes like nqrE

    • Need for improved inducible expression systems specific to Vibrio species

    • Requirements for better reporter systems to study gene expression in native contexts

  • Structural Biology Limitations:

    • Challenges in obtaining sufficient quantities of properly folded protein

    • Difficulties in crystallizing membrane proteins for X-ray crystallography

    • Resolution limitations in cryo-EM studies of smaller membrane proteins

    • Need for improved methods to study dynamic processes at atomic resolution

  • Functional Assay Development Needs:

    • Lack of high-throughput screening methods for Na+-NQR inhibitors

    • Difficulties in measuring sodium translocation with high temporal resolution

    • Limited tools for studying complex assembly in native membranes

    • Need for better methodologies to distinguish between direct and indirect effects in physiological studies

  • Methodological Development Opportunities:

Research AreaCurrent LimitationPotential Methodological Solution
Genetic studiesInefficient transformation of some Vibrio strainsDevelopment of specialized electroporation protocols or conjugation systems
Structural biologyProtein instability during purificationApplication of novel membrane-mimetic systems (nanodiscs, amphipols)
Functional studiesLow temporal resolution of ion translocationDevelopment of ultra-fast fluorescent sodium indicators
In vivo relevanceDifficulty connecting molecular events to pathogenicityEstablishment of standardized infection models with defined readouts
Inhibitor screeningLimited throughput of current assaysDevelopment of cell-based high-content screening approaches
  • Cross-disciplinary Approaches Needed:

    • Integration of computational and experimental methodologies

    • Application of systems biology approaches to understand network effects

    • Development of in situ structural biology methods to study proteins in native environments

    • Implementation of artificial intelligence for data integration and hypothesis generation

Addressing these methodological gaps would substantially accelerate research progress on Vibrio harveyi nqrE and the Na+-NQR complex, potentially leading to both fundamental insights and practical applications in disease control.

How can research on nqrE contribute to broader understanding of bacterial energy metabolism and pathogenicity?

Research on nqrE offers unique opportunities to contribute to our broader understanding of bacterial bioenergetics and pathogenicity mechanisms:

  • Evolutionary Insights:

    • Understanding the adaptive significance of sodium-dependent versus proton-dependent respiratory chains

    • Elucidating the evolutionary history of respiratory complexes across bacterial phyla

    • Identifying convergent solutions to bioenergetic challenges in diverse bacterial species

    • Mapping the co-evolution of respiratory components and virulence factors

  • Fundamental Bioenergetic Principles:

    • Clarifying the mechanistic details of ion coupling to electron transfer reactions

    • Understanding how protein structures evolve to accommodate different coupling ions

    • Discovering general principles governing energy conservation in biological systems

    • Identifying common features and differences between diverse respiratory complexes

  • Pathogenicity Connections:

    • Establishing links between energy metabolism and virulence factor expression

    • Understanding how metabolic adaptation influences host-pathogen interactions

    • Elucidating the role of Na+ gradients in supporting virulence-associated processes

    • Developing models connecting environmental adaptation and pathogenic potential

  • Translational Applications:

    • Identifying novel targets for antimicrobial development

    • Developing diagnostic tools based on nqrE sequence variations

    • Creating vaccines targeting conserved epitopes in respiratory complexes

    • Establishing predictive models for virulence based on metabolic capabilities

  • Interdisciplinary Impacts:

Scientific FieldPotential Contribution from nqrE Research
Structural BiologyNovel mechanisms of ion transport across membranes
Evolutionary BiologyUnderstanding specialized adaptations to marine environments
Systems BiologyIntegration of bioenergetics with global cellular functions
Synthetic BiologyDesign principles for engineering ion-specific energy systems
Environmental MicrobiologyRelationship between energetic capacity and ecological niche

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.